NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS50365.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
50365.1 Public Mus musculus 19 Cdc42bpg 21 106 86 CCDS HistoryNCBI Gene:240505Re-query CCDS DB by CCDS ID:50365.1Re-query CCDS DB by GeneID:240505See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 50365.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000025681 ENSMUSP00000025681 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000025681Link to Ensembl Protein Viewer:ENSMUSP00000025681Re-query CCDS DB by Nucleotide ID:ENSMUST00000025681Re-query CCDS DB by Protein ID:ENSMUSP00000025681
Original member Current member EBI,WTSI OTTMUST00000044838 OTTMUSP00000020170 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000044838Link to Vega Protein Viewer:OTTMUSP00000020170Re-query CCDS DB by Nucleotide ID:OTTMUST00000044838Re-query CCDS DB by Protein ID:OTTMUSP00000020170
Original member Current member NCBI NM_001033342.1 NP_001028514.1 Accepted alive Link to Nucleotide Sequence:NM_001033342.1Link to Protein Sequence:NP_001028514.1Re-query CCDS DB by Nucleotide ID:NM_001033342Re-query CCDS DB by Protein ID:NP_001028514Link to BLAST:NP_001028514.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001028514.1 1551 Q80UW5 1551 100% 0 0

Chromosomal Locations for CCDS 50365.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 19 (NC_000085.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 6306716 6306875 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6309126 6309217 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6309299 6309382 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6309727 6309822 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6310218 6310366 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6310795 6310888 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6311022 6311222 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6311322 6311570 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6312118 6312197 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6313219 6313316 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6313415 6313495 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6313689 6313795 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6313891 6314070 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6314285 6314365 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6314496 6314617 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6314705 6314780 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6314990 6315096 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6315172 6315286 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6315639 6315787 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6315864 6315952 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6316199 6316251 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6316341 6316439 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6316519 6316578 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6316829 6316934 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6317161 6317294 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6317375 6317514 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6317604 6317685 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6318358 6318574 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6320079 6320141 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6320243 6320842 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6321657 6321754 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6321827 6321911 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6322027 6322147 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6322254 6322371 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6322555 6322678 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6322793 6322881 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19
19 6324517 6324573 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19Link to Vega Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4656 nt):
ATGGAGCAGCGGCTGCGTGCGCTGGAGCAGCTGGTACGGGGCGAAGCTGGTGGCAGCCCAGGGCTCGACG
GC
CTCCTGGATCTGCTGCTGGGGGTGCACCAAGAGCTCAGCAGCGCCCCCCTGCGCCGGGAGCGTAACGT
G
GCGCAGTTTCTGAGCTGGGCCAGCCCCTTTGTAACAAAAGTGAAAGAGCTGCGTCTACAGAGAGATGAC
TTT
GAGATCTTGAAGGTGATTGGCAGAGGGGCCTTTGGGGAGGTTGCCGTGGTGAGGCAGAGGGGCAGTG
GC
CAGATCTTTGCCATGAAGATGCTGCATAAGTGGGAGATGCTGAAGAGGGCTGAGACGGCCTGTTTCCG
G
GAGGAGCGAGATGTTCTAGTGAAGGGAGACAGCCGCTGGGTGACTGCTCTGCACTACGCCTTCCAGGAT
GAA
GAGTACCTGTACCTGGTGATGGACTACTATGCTGGCGGGGACCTTCTCACGCTGCTGAGCCGCTTTG
AG
GACCGCCTCCCACCTGAGCTGGCCCAGTTCTATCTGGCTGAGATGGTTCTGGCCATCCACTCACTGCA
C
CAGCTGGGCTATGTCCACAGGGATGTGAAGCCTGACAACATCCTGCTGGACATGAATGGCCACATCCGC
CTG
GCAGACTTTGGCTCCTGCCTGCGTCTCAACAACAATGGCATGGTGGATTCATCAGTCGCAGTTGGGA
CC
CCGGACTACATCTCTCCTGAGATCCTACAGGCCATGGAGGAAGGCAAGGGCCACTACGGCCCACAGTG
T
GACTGGTGGTCACTGGGAGTCTGCGCCTATGAGCTGCTCTTTGGGGAAACACCCTTTTATGCAGAATCT
CTG
GTAGAAACCTACGGCAAGATCATGAACCACGAGGACCACCTCCAGTTCCCTGCTGATGTGACTGATG
TG
CCTGCTAGTGCCCAGGACCTGATCCGACAGCTGCTGTGCCGTCAGGAGGAGCGGCTGGGCCGTGGTGG
G
CTGGACGACTTCCGGAAGCACCCCTTCTTTGAAGGGGTCGATTGGGAGAGGCTTGCAACCAGCACAGCG
CCA
TACATCCCTGAGCTTCGAGGGCCGATGGACACCTCCAACTTCGACGTGGATGATGATACCCTCAACC
GT
CCAGAGACGCTGCCACCATCCTCCCATGGTGCCTTCTCAGGCCACCACCTGCCATTTGTTGGCTTCAC
T
TACACCTCAGGCAGCCCCTTTGATGTGCAGAGCTCAGAGCTAATGGCTGCCCCAGAGGGGACGCCCCAC
TGT
GTGGAGCAGGTGAAAGTGGAGCTCAGCCACAAGTGTCAAGAGCCCCTGCATGGCCCATTACAGCCCC
AG
GAGCTTGTGCGGCTTCAGAAGGAAGTACAGGTTCTTCAGGAGAAACTGGCAGAGACACTGAGGGACAG
C
AAGGCCTCCCTCTCACAAACTGATGGCCTCCATGCTAGAAGCCCAGCCCCAAACATCCAACTACAACAG
GAG
AAGGACCGCCTCCAGCAGGAGCTGACTGAAGCTCAGGCAGCATTGCGAGTGCAGGATGCTGAGCTGT
GC
CAAGCGCAGAACCGGCAGGAAGAATTCCTGCAGAGGCTGTGGGAAGCCCAGGAGAGAGAGGCAGCTGC
A
GCCAGCCAGATCCAGGCCCTGAACTCCCAGCTGGAGGAAGCCTGGGTTGTCCGGAGAGAGCTCGAAGGC
CAG
GTGACCACCCTGAGTCAGGAGGTGACACGGCTCCAGGGACAATGTAAACAAGAATCTTCACAGGCCA
AG
ACCGTCCATGCAGCCCCTGAGACGAACGGCATAGGATCTCCTGAGGGTCAGTCTCAAGAGGCCCAGCT
G
AGGAAGGAAGTGGCGGCTCTGAGGGAGCAGCTGGAGCATGCCTGCAGCCAAGGGATCAGTGTTGGGAAA
GAG
GAGGTTCTGTGCCGATTGCAGGAGGAAAACCAGCGGCTGAGCCGGGAGCAGGAACGGCTGGCAGGAG
AG
CTGGAACTGGAGCTACAGAGCAAGCAGCGTTTGGAGGGTGAACGGCGGGAGACTGAGAGCAACTGGGA
G
GCTCAGATCGCTGACATCCTCAGCTGGGTGAATGACGAGAAGGTCTCAAGAGGCTACCTGCAGGCCTTG
GCT
ACTAAGATGGCTGAGGAGCTGGAGTCCTTGAGGAATGTGGGCACGCAGACACTCCCTACCCGGCCTC
TG
GATCACCAGTGGAAGGCTCGGAGGCTGCAGAAGATGGAGGCCTCAGCCCGGCTAGAGCTTCAGTCAGC
A
CTGGAAGCTGAGATCCGTGCCAAGCAGAGTCTGCAGGAGCAGCTGACGCAGGTGCAGGAGGCTCAGCGG
CAG
GCTGAACGCCGCCTGCAGGAGGCTGAGAAGCAAAGTCAGGCCCTGCAGCAGGAGGTGGCTGAGCTCC
GG
GAGGAACTGCAAGCTCGAGGACCGGGGGATGCCAGGCCTTCCACTTCCCTCATCCCTCTCCTGTCCTT
C
TGGAACACAGAGAAGGATTCTGCCAAGGACCCTGGCAATTCAGGAGAGGGTCCAAGGTCTGGAGCCGAA
GCA
GAGCTGAGGCCAGAGGGCCGCCGCAGTCTGCGCATGGGGAGTGTGTTCCCCAGGGTGCCCGCAGCCA
CC
ACCACCCCTGCCGAAGGTCCTCCTGCTAAGCCCGGCTCACACACCCTGCGTCCCCGGAGTTTTCCATC
C
CCTACCAAGTGTCTCCGCTGCACCTCGCTGATGCTGGGCCTGGGCCGCCAGGGCCTGGGCTGTGACACC
TGT
GGCTACTTCTGTCACTCAGCTTGTGCGTCACAAGCCCCACCTTGCCCTGTGCCCCCTGAACTCCTCC
GC
ACAGCCTTGGGGGTGCACCCCGAAACAGGCACAGGGACTGCCTATGAGGGCTTCCTGTCGGTGCCGCG
G
CCCTCAGGTGTCCGTCGGGGCTGGCAGCGGGTGTACGCCGCTCTCAGTGACTCCCGCCTGTTGTTGTTT
GAT
GCTCCTGACCCTCGAGGCAGCCTGGCCAGTGGGGTCCTCCTGCAGGCCTTGGATCTAAGGGACCCCC
AG
TTCTCAGCCACCCCTGTCTTGGCCCCAGATGTCATTCATGCCCAATCCAAGGACCTGCCACGTATCTT
C
AGGGTGACAGCCTCCCAGCTGACAGTGCCACCAACCACATGCACTGTGCTGCTGCTGGCAGAGAATGAG
GGG
GAGCGGGAGCGCTGGCTTCAGGTGCTGGGGGAGCTGCAGCGGCTGCTACTGGATGCACGTCCAAGGC
CC
CGACCGGTGTACACACTCAAGGAGGCCTATGACAATGGGCTGCCACTGCTGCCTCATGCGCTCTGTGC
T
GCTGTCATTGACCAAGAGCGTCTTGCCCTGGGCACTGAGGAGGGGTTGTTTGTGATCCATCTTCACAGC
AAT
GACATCTTCCAGGTGGGAGACTGCCGCCGGGTGCAGCGGTTGGCTGTGAGCTCTGCGGCTGGCCTCC
TG
GCTGTGCTCTGTGGCCGTGGCCCCAGTGTGCGCCTCTTCGCCCTGGACGAACTGGAGAGTGCTGAGGT
G
GCGGGTGCCAAGATCCCGGAATCCCGAGGCTGTCAGGCTTTGGTCGCTGGGCGCATCTTGCAGGCCCGG
ACT
CCAGTGCTCTGTGTGGCAGTCAAACGCCAAGTTCTCTGTTACCAGCTGGGCCCAGGACCAGGGCCCT
GG
CAGCGCCGCATCCGAGAGCTGCAAGCACCAGCTCCGGTGCAGAGCCTGGGCTTGCTGGGTGATCGGCT
C
TGTGTGGGCGCCGCAGGCACCTTCGCTCTCTACCCGCTGCTCAATGAGGCTGCACCCTTAGCGCTGGGA
ACT
GGTCTGGTGGCCGAGGAGCTGCCTGCATCCCGTGGGGGCCTAGGTGAGGCACTGGGTGCCGTGGAGC
TC
AGCCTCAGCGAGCTCCTGCTGCTCTTCGCCACTGCCGGCGTCTACGTGGATAGTGCTGGCCGCAAGTC
A
CGAAGCCACGAGCTGCTGTGGCCAGCTGCACCCACTGGCTGGGGTTACACAGCACCCTACCTAACAGTG
TTC
AGTGAAAACGCCCTTGATGTGTTTGACGTGAGGAGAGCAGAATGGGTACAGACTGTGCCGCTCAAGA
AG
GTGAGACCCCTGAATCCAGAAGGCTCCTTGTTCCTTTATGGCACCGAGAAGGTCCGCCTGACCTACCT
C
AGGAATCCATTGGCAGAGAAGGACGAGTTTGACATTCCCGACCTCACGGACAACAGCCGGCGCCAGCTG
TTC
CGCACCAAGAGCAAGCGCCGTTTCTTCTTCCGGGTGTCTGATGAGCTGCGACAGCAGCAGCGCAGGG
AG
ATGCTGAAGGACCCTTTTGTGCGCTCCAAGTTCATCTCGCCGCCCACCAACTTCAACCACCTGGTGCA
C
GTGGGCCCTACGGAGGGAAGGCCCAACACCAGGGATGGGACCCGGGCTCAGGAACAGAAGAGCAGAGGT
GCC
CGCAGCTCCGGGCCGCAGCGGCCCCACAGCTTCTCAGAGGCATTTCGGCGGCCAGTGTCCACGGGCA
GT
GATGGTCTCCCTGGAGAAACAGACCCATTAGTGAAGAGGAAACCTTGGACATCTCTGTCCAGCGAATC
A
GTGTCCTGCCCCCAGGGGTCCCTGAGCCCTGCAGCATCCCTGATACAGGTCTCAGAACGGCCCCGAAGT
CTC
CCTCCAGATCCTGAGTCAGAGAGCTCCCCCTGA


Translation (1551 aa):
MEQRLRALEQLVRGEAGGSPGLDGLLDLLLGVHQELSSAPLRRERNVAQFLSWASPFVTKVKELRLQRDD
F
EILKVIGRGAFGE
VAVVRQRGSGQIFAMKMLHKWEMLKRAETACFREERDVLVKGDSRWVTALHYAFQD
E
EYL
YLVMDYYAGGDLLTLLSRFEDRLPPELAQFYLAEMVLAIHSLHQLGYVHRDVKPDNILLDMNGHIR
L
ADFGSCLRLNNNGM
VDSSVAVGTPDYISPEILQAMEEGKGHYGPQCDWWSLGVCAYELLFGETPFYAES
L
VETYGKIMNHE
DHLQFPADVTDVPASAQDLIRQLLCRQEERLGRGGLDDFRKHPFFEGVDWERLATSTA
P
YIPELRGPMDTSNFDVDDDTLNRP
ETLPPSSHGAFSGHHLPFVGFTYTSGSPFDVQSSELMAAPEGTPH
C
VEQVKVELSHKCQ
EPLHGPLQPQELVRLQKEVQVLQEKLAETLRDSKASLSQTDGLHARSPAPNIQLQQ
E
KDRLQQ
ELTEAQAALRVQDAELCQAQNRQEEFLQRLWEAQEREAAAASQIQALNSQLEEAWVVRRELEG
Q
VTTLSQEVTRLQGQCKQESSQAK
TVHAAPETNGIGSPEGQSQEAQLRKEVAALREQLEHACSQGISVGK
E
EVLCRLQEENQRLSREQER
LAGELELELQSKQRLEGERRETESNWEAQIADILSWVNDEKVSRGYLQAL
A
TKMAEELESLRNVGTQTLPTRPL
DHQWKARRLQKMEASARLELQSALEAEIRAKQSLQEQLTQVQEAQR
Q
AE
RRLQEAEKQSQALQQEVAELREELQARGPGDARPSTSLIPLLSFWNTEKDSAKDPGNSGEGPRSGAE
A
ELRPEGRRSLRMG
SVFPRVPAATTTPAEGPPAKPGSHTLRPRSFPSPTKCLRCTSLMLGLGRQGLGCDT
C
GYFCHSACASQAPPCPVPPELLRTALGVHPETGTGTAYEGFLS
VPRPSGVRRGWQRVYAALSDSRLLLF
D
APDPRGSLASGVLLQALDL
RDPQFSATPVLAPDVIHAQSKDLPRIFRVTASQLTVPPTTCTVLLLAENE
G
ERERWLQVLGELQRLLLDARPRPRPVYTLKEAYDNGLPLLPHALCAAVI
DQERLALGTEEGLFVIHLHS
N
DIFQVGDCRRVQRLAVSSAAGLLAVLCGRGPSVRLFALDELESAEVAGAKIPESRGCQALVAGRILQAR
T
PVLCVAVKRQVLCYQLGPGPGPWQRRIRELQAPAPVQSLGLLGDRLCVGAAGTFALYPLLNEAAPLALG
T
GLVAEELPASRGGLGEALGAVELSLSELLLLFATAGVYVDSAGRKSRSHELLWPAAPTGW
GYTAPYLTV
F
SENALDVFDVRRAEWVQTVPLKK
VRPLNPEGSLFLYGTEKVRLTYLRNPLAEKDEFDIPDLTDNSRRQL
F
RTKSKRRFFFRVSDELRQQQR
REMLKDPFVRSKFISPPTNFNHLVHVGPTEGRPNTRDGTRAQEQKSRG
A
RSSGPQRPHSFSEAFRRPVSTGSDGLPGETDP
LVKRKPWTSLSSESVSCPQGSLSPAASLIQVSERPRS
L
PPDPESESSP




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser