NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS50227.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
50227.1 Public Mus musculus 18 Taf4b 23 108 98 CCDS HistoryNCBI Gene:72504Re-query CCDS DB by CCDS ID:50227.1Re-query CCDS DB by GeneID:72504See the combined annotation on chromosome 18 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 50227.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000169862.1 ENSMUSP00000126909.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000169862.1Link to Ensembl Protein Viewer:ENSMUSP00000126909.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000169862Re-query CCDS DB by Protein ID:ENSMUSP00000126909
Original member Current member NCBI NM_001100449.2 NP_001093919.1 Accepted alive Link to Nucleotide Sequence:NM_001100449.2Link to Protein Sequence:NP_001093919.1Re-query CCDS DB by Nucleotide ID:NM_001100449Re-query CCDS DB by Protein ID:NP_001093919Link to BLAST:NP_001093919.1

Chromosomal Locations for CCDS 50227.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 18 (NC_000084.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18See the combined annotation on chromosome 18 in Sequence Viewer

Chromosome Start Stop Links
18 14783595 14783934 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 14796913 14797058 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 14799079 14799186 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 14804466 14804627 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 14804717 14804839 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 14807345 14807434 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 14813091 14813690 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 14821438 14821570 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 14822094 14822205 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 14830019 14830188 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 14835792 14835922 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 14841905 14842030 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 14844414 14844470 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 14859172 14859276 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 14897964 14898128 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2568 nt):
ATGCCGGCGGGCCTCACGGAGCCGGCCGGCGCCGCTGCTCCTGTAGTCTCGAGCGCGTCGGGGGCCGTGA
CC
ATGGCTCCGGTCGCCGCGCTGCCCGTCCGGGTGGAGGGCACCCCGGTGGCCCTGGGCCCTGTGACTAA
G
GCTCCTGTCAGTGTTTGCGTGGAGTCTGTGGCGCCCCAGCCCTTGCCAGCCCCAGTGGGGACTCTAGTG
ACC
AAAGTGGTTCCTGTCACTGCCCTTCCTAAACTCGGCAGCCCTAGGCTGCCCGCTCCTCAGATAGTCA
CC
GTGAAAACGCCGGGCACCACGACAATCCAACTACCGGCTAATTTGCAGCTTCCTCCAGGAACAGTTTT
G
ATCAAAAGTAACAGTGGTCAGTTGATGCTGGTATCGCCTCAGCAAGCTGTAACAGGAGCCAAGACCACA
AGT
AACATAACTCCAAGACCAGCAGTACCAGCAAACACTCAAACAGTAAAGATCTGTACAGTGCCGAATT
CT
AGCTCACAATTAATGAAGAAAGTAACAGTGGCGCCTGTTAAAAATTTGACACAGATAGGAACTACTGT
G
GCAACCACTGCCTCCAGTACTTCCTCAGGACAACCTGTGGCTCTACCAAGCAGTGTCATCACAGTTACT
CCT
GCAAAGCTGGTGAATACTGTATCCACCCTGAAGTCATCAAGTTTGGGAGTGTTATCTACCCCCTCAA
AT
GACGCACGTCTCAAAGCTGAGACTTCAGTAGCTGCTCAGACTGCTCTTCCTCCGACAGTGCTAGAAAA
T
GTGAAAAAATGTAAAAACTTCCTTTCAATGTTAATAAAACTAGCATGTAGTGGATCACAGTCTCCAGAA
ATG
GGGCAGAATGTGAAGAGGCTGGTGGAGCAGCTTTTGGATGCAGAAATTGAAGCAGAAGAGTTTACTA
GG
AAACTGTATATTGAACTCAAGTCTGCACCTCAGCCGCACCTCGTCCCTTTTCTTAAGAAGAGTGTGGT
T
GCCCTAAGACAGCTTCTTCCAAATTCCCAGAGCTTCATTGAGAACTGTGTGAAGGAAGTTTCTGGTGAT
GTG
GTCATTTCCTCCTGTACCATGACAACAGCAACGTCTCCTGTGGTGACAAGTACAGTTTCCCCAGTCC
TT
GTGTCTGGAGCAACAGCACCCAGAACTCTGTCTGTTCAGCAGACCCTGAATCCACTTGCTGGTCCAGG
A
GTAGCAAACACTGGAGTTGTGACACTGCATTCTGTTGCCCCAGCTGCTGCAACAGGAGGTACGACAGCT
GCA
ACTGTTTTGCTTCAAACTTCAAAACCACTAACAACATCAGTACCAAATACAGTGGCAGCAGTGTCCC
TT
CAGCCTGAGAATCCAGTTGTGTCTGGGGCAGCAGTAACACTGGCTATTCCATCAGCAACTTTTGGAGA
A
GCGTCCGCTACACCTCTTTGTCTTCCATCTGCGAAGCCTGCCATTACCTCTGCTGGGACCAAAGCTGAT
AAA
CCTGCCATTGGCACTCCAGTCCAGATCGTTACACAACCGAGCACCCTCCTTCCACAGGCGGCTGGCA
TT
CCACAGACAGCCAAAGTCAAGCAACTAGTTGTACAGCAGCCTTCAGGAAGCAGTGTGAATCATGTGAC
C
TCCATTTCCCATTCCTCACCATTGAGCACTCAGAACTGTGGGCAGAAGACACCAGTAAATGCTGTGATG
CCT
ACTAGTAAGTTTCCTCCATCTTCCATCATAAAGCAAATTACTCTGCCTGGAAATAAACTTTTGTCGC
TT
CAAGCTCAAAGATCTTCTATTCAGAGCAATAAAATAAAAGAGAATGGACCAACATGCTTCAGAGGTGA
A
GATGACATCAATGATGTGACTTTCATGGCAGAGGTCAACCTTGATGAAGAAAATGCCTGCATCTTAGCA
GCA
CATTCTGACTTTGTTGGCACACTTATTCAGTCATGTAAAGAAGAACCATTCCTTGTCATTGGAGCTC
TA
CAGAAGAGAATTTTAGACATTGGTAAAAAGCATGACATTACAGAACTTAACTCTGATGCTGTGAACTT
G
ATCTCCCATGCAACACAGGAGAGATTACGAGGCCTTCTAGAGAAACTAACTACAATTGCTCAGCATCGA
ATG
ACTATTTACAAGGGAAGTGAAAATTATATCTTGTCTACTGATACCAGATCACAGCTCAAATTTCTTG
AA
AAGCTCGATCAGTTGGAGAAACAGAGGAAGGATTTAGAAGAAAGAGAGATGTTACTAAAGGCAGCCAA
G
AGTCGCTCCAATAAAGAAGATCCAGAGCAGCTGAGATTAAAACAAAAAGCCAAAGAGTTGCAGCAGTTG
GAG
CTTGCCCAGATCCAGTACAGAGATGCTAATCTCACAGCTCTTGCAGCTATTGGACCAAGGAAGAAGA
GA
CCACTAGAATCAGGAAATGAGAGCTTCAAAGATAACCCTTCTACTTCTGGGACTTCCAGCCTAACAGC
C
ACCAAACCATTTCGTCCAAGAATCACAAGAATCTGCCTCAGGGATTTGATATTCTGTATGGAACAGGAA
AGA
GAGATGAAGTATTCTCGAGCCCTATACCTTGCCCTTCTTAAGTGA


Translation (855 aa):
MPAGLTEPAGAAAPVVSSASGAVTMAPVAALPVRVEGTPVALGPVTKAPVSVCVESVAPQPLPAPVGTLV
T
KVVPVTALPKLGSPRLPAPQIVTVKTPGTTTIQLPANLQLPP
GTVLIKSNSGQLMLVSPQQAVTGAKTT
S
NITPRPAVPANTQTVKICTVP
NSSSQLMKKVTVAPVKNLTQIGTTVATTASSTSSGQPVALPSSVITVT
P
AKLVNTVSTLKSSSLGVLSTPSNDARLKAETSVAAQTALPP
TVLENVKKCKNFLSMLIKLACSGSQSPE
M
GQNVKRLVEQLL
DAEIEAEEFTRKLYIELKSAPQPHLVPFLKKSVVALRQLLPNSQSFIENCVKEVSGD
V
VISSCTMTTATSPVVTSTVSPVLVSGATAPRTLSVQQTLNPLAGPGVANTGVVTLHSVAPAAATGGTTA
A
TVLLQTSKPLTTSVPNTVAAVSLQPENPVVSGAAVTLAIPSATFGEASATPLCLPSAKPAITSAGTKAD
K
PAIGTPVQIVTQPSTLLPQAAGIPQTAKVKQL
VVQQPSGSSVNHVTSISHSSPLSTQNCGQKTPVNAVM
P
TSKFPP
SSIIKQITLPGNKLLSLQAQRSSIQSNKIKENGPTCFRGEDDINDVTFMAEVNLDEENACILA
A
HSDFVGTLIQSCKEEPFLVIGALQKRILDI
GKKHDITELNSDAVNLISHATQERLRGLLEKLTTIAQHR
M
TIYK
GSENYILSTDTRSQLKFLEKLDQLEKQRKDLEEREMLLKAAKSRSNKEDPEQLRLKQKAKELQQL
E
LAQIQYRDANLTALAAIGPRKKRPLESGNE
SFKDNPSTSGTSSLTATKPFRPRITRICLRDLIFCMEQE
R
EMKYSRALYLALLK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser