NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS49859.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
49859.1 Public Mus musculus 16 Cd200r3 23 108 98 CCDS HistoryNCBI Gene:74603Re-query CCDS DB by CCDS ID:49859.1Re-query CCDS DB by GeneID:74603See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 49859.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000171779.7 ENSMUSP00000132938.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000171779.7Link to Ensembl Protein Viewer:ENSMUSP00000132938.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000171779Re-query CCDS DB by Protein ID:ENSMUSP00000132938
Original member Current member NCBI NM_027578.1 NP_081854.1 Accepted alive Link to Nucleotide Sequence:NM_027578.1Link to Protein Sequence:NP_081854.1Re-query CCDS DB by Nucleotide ID:NM_027578Re-query CCDS DB by Protein ID:NP_081854Link to BLAST:NP_081854.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_081854.1 202 Q5UKY4-9 202 100% 0 0

Chromosomal Locations for CCDS 49859.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 16 (NC_000082.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 44943773 44943836 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 44951439 44951549 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 44953402 44953719 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 44957728 44957833 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 44980796 44980805 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (609 nt):
ATGCATGCTTTGGGGAGGACTCTGGCTTTGATGTTACTCATCTTCATCACTATTTTGGTGCCTGAGTCAA
GT
TGTTCAGTGAAAGGACGGGAGGAGATCCCACCGGATGATTCATTTCCTTTTTCAGATGATAATATCTT
C
CCTGATGGAGTGGGCGTCACCATGGAGATTGAGATTATCACTCCAGTGTCTGTACAGATAGGTATCAAG
GCT
CAGCTTTTCTGTCATCCTAGTCCATCAAAAGAAGCAACACTTAGAATATGGGAAATAACTCCCAGAG
AC
TGGCCTTCCTGCAGACTACCCTACAGAGCAGAGTTGCAGCAGATCAGTAAAAAAATCTGTACTGAGAG
A
GGAACCACTAGGGTCCCTGCACATCACCAGAGTTCTGACCTTCCCATCAAATCAATGGCCCTCAAGCAT
GAT
GGGCATTACTCATGTCGGATAGAAACAACAGATGGGATTTTCCAAGAGAGACATAGCATCCAAGTGC
CA
GGTACAACCAGCATCCTGCCTTCCTTGCTGAGCATTCTCTATGTGAAACTGGCTGTAACTGTTCTCAT
C
GTAGGATTTGCTTTTTTCCAGAAGAGAAATTATTTCAGGTGGATCTAA


Translation (202 aa):
MHALGRTLALMLLIFITILVPESSCSVKGREEIPPDDSFPFSDDNIFPDGVGVTMEIEIITPVSVQIGIK
A
QLFCHPSPSKEATLRIWEITPRDWPSCRLPYRAELQQISKKICTERGTTRVPAHHQSSDLPIKSMALKH
D
GHYSCRIETTDGIFQERHSIQVP
GTTSILPSLLSILYVKLAVTVLIVGFAFFQKRNYFRWI



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser