NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS49702.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
49702.1 Reviewed, update pending Mus musculus 15 Klhdc7b 21 106 86 CCDS HistoryNCBI Gene:546648Re-query CCDS DB by CCDS ID:49702.1Re-query CCDS DB by GeneID:546648See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 49702.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000166926 ENSMUSP00000130884 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000166926Link to Ensembl Protein Viewer:ENSMUSP00000130884Re-query CCDS DB by Nucleotide ID:ENSMUST00000166926Re-query CCDS DB by Protein ID:ENSMUSP00000130884
Original member Current member EBI,WTSI OTTMUST00000117953 OTTMUSP00000065882 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000117953Link to Vega Protein Viewer:OTTMUSP00000065882Re-query CCDS DB by Nucleotide ID:OTTMUST00000117953Re-query CCDS DB by Protein ID:OTTMUSP00000065882
Original member NCBI NM_001160178.1 NP_001153650.1 Updated not alive Link to Nucleotide Sequence:NM_001160178.1Link to Protein Sequence:NP_001153650.1Re-query CCDS DB by Nucleotide ID:NM_001160178Re-query CCDS DB by Protein ID:NP_001153650
Current member NCBI NM_001160178.2 NP_001153650.2 Pending alive Link to Nucleotide Sequence:NM_001160178.2Link to Protein Sequence:NP_001153650.2Re-query CCDS DB by Nucleotide ID:NM_001160178Re-query CCDS DB by Protein ID:NP_001153650Link to BLAST:NP_001153650.2

Chromosomal Locations for CCDS 49702.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 89386891 89388708 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1818 nt):
ATGGTTCTTAGAAGCCACCCCTTCCCCAGGCAAGAAAAGGCCCAAGGTAGTGCCCCAAGGGCAGATCCGG
AG
AGTCCTGCAGGGCCCAGCCCATCCACATACTCTGAAGATATACAACCAGGGTCCTCCTCTGAAGGCGC
C
ATCTTCAGCCTCCAGGACAAACACAGACCAGTCTTAGTCACAGCAGTAGGTTCAGAGAGCCTAGCTGAG
GCT
AGATGTGAAACACAACCAGTGAGTTTAGAGACTAATGCATCTCTCACCCCGGACCCGAGAGGGGATG
AA
ACCAAGCAGAAGAGTCTAGACTTGCTGCCCCCGGCTGCAGAGCCTGTGGCTTCCCCGCAGGTCCCTGT
T
TCGGCACAGCCCGGTCCTGTACCGCCTACTTCTATGAGGCAGGATGCTCAGCCCACCCCTCAGCCTCGG
CAA
CGGAGGAGGAAACGCAGCATAGCTCAGAGCTCCGAACACATACTGATCCAGGAAGTACCCCAGCAGC
CC
CAGGGGCAGGTGCGAAAGGAGGGAGCCAGACCTACAGACTGCAGGGACATCCTCACAGAGAAGCAGAA
A
GAGACCCAAAAGCTTATGGCTTTTCTGCAGAAGCCTGGGAGTTGGGGAGTGGTGGAGGGGCCTCATAAG
TAC
TGCTCACAGACCTCGCAGCCTAGCAGCCTAGTGGCGCCGTGGCCCCCGAAGCTAGATCTAGGGAGCT
GC
CTGGAGGTTTTGGCCTTCGCCCAGCAGCACGGAGAACTGGGCTTAGCCCAGGAGACCTATGTCTTGAT
G
AGCAACAACTTACTGCATGTTCTGGGAGACCCACACCTCTACCGACAGCTGAGTGGAGCAGACAGGGAG
CGC
ATCCTGAACCTGCGGACGTGCCAGGGCCAGACAGTGCTGGGGGTCCTCGTGCTACCCAGCCTTTATC
AG
GTGAGCCGCTCGGGGCTCACGAGGGGCCCTCCCAGCGAGGAAGCTCCTGCAGCCAGGTCTGAGCACTT
G
CATCTTCACACATACCTCCATGTATTCAACCCACAAGAGAATGTGTGGTGGCCCCTGACTCAAGTACCA
GAG
GAGGTCCCCCTTCGGGGCTGTGGCCTCTGCACTATGCATAACTATCTGTTTCTGGCAGGCGGCATCA
GG
GGTTCTGGTGCCAAGGCTGTCTGCTCCAACAAGGTGTTCTGCTACAACCCTCTGACCAATATTTGGAG
C
CAGATTCGGCCCATGCAGCAAGCCCGGGCCCAGCTCAAGCTGGTGGCCCTGGATGGAATGCTTTATGCC
ATT
GGTGGCGAGTGCCTATACAGCATGGAGCGCTATGACCCACGCACAGATACCTGGACCTTGAGAGCAT
CC
CTCCCTGAGGGCACCTTTCCCGTGGCCCACGAGGCTGTGGTCTGCCGAGGAGAGATCTACGTCACAGG
G
GGTCATCTCTTTTACCGCCTGCTCAGATACAGCCCCATGAAAGACTCATGGGATGAGTGTCCCTACAGC
GCC
AGCCACCGACGCTCCAGTGATATGGTGGCGCTAGGGGGCTTCCTATACCGCTTTGACTTGTTGCGGG
GT
GTGGGTGCTGCGGTGATGCGCTACAACACAGTGACCGGCTCCTGGAGCCGGGCAGCCTCCCTGCCACT
G
TCTGACCCCGCCCCACTCCACTGCACGGTATTGGGCAACACCATTTACTGTCTCAACCACCAGGTCACG
GCT
ACCTTCACAGTTTCGGAGGGGACCGCCCTGTTTCAGGCCAAGGAGCTGCAGCCCTTCCCACTGGGAA
GT
AAGGGGGTCCTCTATCCGTTCACTCTGACTCTGCCCCCTAAGACCTGGTTGCAGACCACAATCTGA


Translation (605 aa):
MVLRSHPFPRQEKAQGSAPRADPESPAGPSPSTYSEDIQPGSSSEGAIFSLQDKHRPVLVTAVGSESLAE
A
RCETQPVSLETNASLTPDPRGDETKQKSLDLLPPAAEPVASPQVPVSAQPGPVPPTSMRQDAQPTPQPR
Q
RRRKRSIAQSSEHILIQEVPQQPQGQVRKEGARPTDCRDILTEKQKETQKLMAFLQKPGSWGVVEGPHK
Y
CSQTSQPSSLVAPWPPKLDLGSCLEVLAFAQQHGELGLAQETYVLMSNNLLHVLGDPHLYRQLSGADRE
R
ILNLRTCQGQTVLGVLVLPSLYQVSRSGLTRGPPSEEAPAARSEHLHLHTYLHVFNPQENVWWPLTQVP
E
EVPLRGCGLCTMHNYLFLAGGIRGSGAKAVCSNKVFCYNPLTNIWSQIRPMQQARAQLKLVALDGMLYA
I
GGECLYSMERYDPRTDTWTLRASLPEGTFPVAHEAVVCRGEIYVTGGHLFYRLLRYSPMKDSWDECPYS
A
SHRRSSDMVALGGFLYRFDLLRGVGAAVMRYNTVTGSWSRAASLPLSDPAPLHCTVLGNTIYCLNHQVT
A
TFTVSEGTALFQAKELQPFPLGSKGVLYPFTLTLPPKTWLQTTI




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser