NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS49619.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
49619.1 Public Mus musculus 15 Kcnq3 21 106 86 CCDS HistoryNCBI Gene:110862Re-query CCDS DB by CCDS ID:49619.1Re-query CCDS DB by GeneID:110862See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 49619.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000070256 ENSMUSP00000063380 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000070256Link to Ensembl Protein Viewer:ENSMUSP00000063380Re-query CCDS DB by Nucleotide ID:ENSMUST00000070256Re-query CCDS DB by Protein ID:ENSMUSP00000063380
Original member Current member EBI,WTSI OTTMUST00000118148 OTTMUSP00000065972 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000118148Link to Vega Protein Viewer:OTTMUSP00000065972Re-query CCDS DB by Nucleotide ID:OTTMUST00000118148Re-query CCDS DB by Protein ID:OTTMUSP00000065972
Original member NCBI NM_152923.2 NP_690887.2 Updated not alive Link to Nucleotide Sequence:NM_152923.2Link to Protein Sequence:NP_690887.2Re-query CCDS DB by Nucleotide ID:NM_152923Re-query CCDS DB by Protein ID:NP_690887
Current member NCBI NM_152923.3 NP_690887.2 Accepted alive Link to Nucleotide Sequence:NM_152923.3Link to Protein Sequence:NP_690887.2Re-query CCDS DB by Nucleotide ID:NM_152923Re-query CCDS DB by Protein ID:NP_690887Link to BLAST:NP_690887.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_690887.2 873 Q8K3F6 873 100% 0 0

Chromosomal Locations for CCDS 49619.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 65995171 65995905 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 65997701 65997785 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 66000017 66000115 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 66002195 66002326 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 66004722 66004824 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 66005772 66005974 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 66016449 66016475 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 66020287 66020381 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 66021741 66021836 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 66023647 66023757 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 66025114 66025269 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 66028625 66028797 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 66030519 66030645 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 66031380 66031470 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 66285836 66286224 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2622 nt):
ATGGGTCTCAAGGCTCGCAGGGCGGCGGGGGCGGCTGGCGGGGGCGGCGGCGAAGGGGGCGGCGGCGGCG
GC
GGGGCCGCTAACCCTGCTGGAGGGGACTCGGCGGTGGCCGGCGACGAGGAGCGGAAAGTGGGGCTGGC
G
CCAGGAGACGTGGAGCAAGTCACCTTGGCGCTAGGGGCCGGAGCCGACAAAGACGGGACCCTGCTGCTG
GAG
GGCGGTGGCCGCGAAGAGGGGCAGAGGAGGACCCCGCAGGGCATCGGGCTCCTGGCAAAGACCCCCC
TG
AGCCGCCCAGTCAAGAGGAACAACGCCAAGTACAGGCGCATCCAAACTTTGATCTATGACGCCCTGGA
G
AGACCGCGGGGCTGGGCGCTGCTCTACCACGCGCTTGTGTTCCTGATTGTCCTGGGATGCTTGATTCTG
GCC
GTGCTCACCACCTTCAAGGAATATGAGACTGTGTCTGGAGACTGGCTTTTGCTGCTGGAAACCTTTG
CT
ATTTTCATCTTTGGAGCTGAGTTTGCTTTGAGGATCTGGGCTGCAGGATGTTGCTGTCGATACAAAGG
C
TGGCGTGGACGGCTAAAGTTTGCCAGGAAGCCCCTGTGCATGTTGGACATCTTCGTACTGATTGCCTCT
GTG
CCAGTGGTTGCCGTGGGAAACCAGGGCAATGTCTTGGCCACCTCCCTGCGAAGCCTTCGCTTCCTGC
AG
ATCCTGCGCATGCTTCGAATGGATAGGAGGGGTGGCACCTGGAAGCTCCTGGGCTCGGCTATCTGTGC
C
CACAGCAAAGAACTCATCACTGCCTGGTACATAGGCTTCCTGACACTCATCCTTTCTTCATTTCTTGTC
TAC
CTGGTGGAGAAGGATGTGCCAGAGATGGATGCCCAAGGAGAGGAAATGAAGGAGGAGTTTGAGACCT
AT
GCAGATGCTCTGTGGTGGGGCCTGATCACACTGGCCACCATTGGTTATGGAGACAAGACACCTAAAAC
C
TGGGAAGGACGTCTGATTGCTGCCACCTTTTCTTTAATCGGCGTCTCCTTTTTTGCCCTTCCGGCAGGC
ATC
CTTGGCTCAGGACTGGCACTGAAGGTTCAGGAGCAGCACCGTCAGAAGCACTTTGAGAAGAGAAGGA
AG
CCAGCTGCGGAACTCATCCAGGCTGCCTGGAGATATTATGCTACCAACCCCAACAGGTTGGATCTGGT
G
GCAACCTGGAGATTTTATGAATCAGTTGTCTCTTTCCCATTCTTCAGGAAAGAACAACTGGAAGCAGCA
GCC
AGCCAAAAGCTGGGTCTCTTGGATCGGGTTCGCCTTTCTAATCCTCGTGGTAGCAATACTAAAGGAA
AG
CTATTTACCCCTCTGAATGTAGATGCCATAGAAGAAAGCCCTTCCAAAGAGCCAAAGCCTGTTGGCTT
A
AACAATAAAGAGCGTTTCCGCACCGCCTTCCGCATGAAAGCCTACGCTTTCTGGCAGAGTTCTGAAGAT
GCT
GGGACAGGCGACCCCATGGCAGAAGACAGGGGCTATGGGAATGACTTCCTCATTGAAGACATGATCC
CT
ACCCTAAAGGCTGCCATCCGAGCTGTCAGAATTCTACAGTTCCGTCTATATAAAAAAAAGTTCAAGGA
G
ACGTTGAGGCCTTATGATGTGAAAGATGTGATTGAGCAGTATTCGGCCGGACATCTTGACATGCTTTCC
AGG
ATAAAGTACCTACAGACAAGAATAGATATGATTTTCACCCCTGGACCTCCATCCACTCCAAAACATA
AG
AAGTCTCAGAAAGGGTCAGCATTTACCTACCCATCCCAGCAGTCTCCAAGGAATGAACCATATGTAGC
C
AGGGCAGCCACATCAGAAACTGAAGACCAAAGCATGATGGGGAAGTTTGTAAAAGTTGAAAGACAGGTT
CAT
GACATGGGGAAGAAACTGGACTTCCTCGTGGACATGCATATGCAGCATATGGAACGCTTACAGGTAC
AT
GTCACTGAGTACTACCCAACTAAGGGGGCCTCCTCCCCAGCCGAAGGGGAGAAGAAAGAAGACAACAG
G
TACTCTGATTTGAAAACCATCATCTGCAACTACTCAGAGACAGGGCCCCCTGACCCTCCTTACAGCTTC
CAC
CAGGTGCCCATCGACAGAGTTGGCCCTTACGGGTTTTTTGCACATGATCCTGTGAAACTGACCCGAG
GG
GGACCCAGTTCTACAAAGGCTCAAGCTAACCTTCCCTCCTCGGGAAGTACATATGCAGAGAGGCCCAC
A
GTCCTGCCCATCTTGACTCTTCTGGACTCATGTGTGAGCTACCACTCCCAGACAGAACTGCAAGGTCCC
TAT
TCGGACCACATCTCGCCCCGCCAGAGACGCAGCATCACTAGGGACAGTGATACACCTCTGTCCCTCA
TG
TCCGTCAATCACGAGGAACTGGAGCGGTCTCCAAGTGGCTTCAGCATCTCACAAGACAGAGATGATTA
T
GTATTTGGCCCCAGTGGGGGATCGAGCTGGATGAGGGAAAAGCGGTACCTGGCTGAAGGAGAAACGGAC
ACG
GACACAGACCCCTTCACACCCAGTGGTTCCATGCCTATGTCATCCACTGGGGATGGTATTTCAGATT
CC
ATATGGACCCCTTCCAACAAGCCCACTTAA


Translation (873 aa):
MGLKARRAAGAAGGGGGEGGGGGGGAANPAGGDSAVAGDEERKVGLAPGDVEQVTLALGAGADKDGTLLL
E
GGGREEGQRRTPQGIGLLAKTPLSRPVKRNNAKYRRIQTLIYDALERPRGWALLYHAL
VFLIVLGCLIL
A
VLTTFKEYETVSGDWLLLL
ETFAIFIFGAEFALRIWAAGCCCRYKGWRGRLKFARKPLCMLDIFVLIAS
V
PVVAVGNQGNVLATSLRSLRFLQILRMLRMDRRGGTWKLLGSAICAHSK
ELITAWYIGFLTLILSSFLV
Y
LVEKDVPEMDAQGEEMKEEFETYADALWWGL
ITLATIGYGDKTPKTWEGRLIAATFSLIGVSFFALPAG
I
LGSGLALKVQEQHRQKHFEKRRKPAAELIQ
AAWRYYATNPNRLDLVATWRFYESVVSFPFFRKEQLEAA
A
SQKLGLLDRVRLSNPRGSNTKGKLFTPLNVDAIEESPSKEPKPVGLNNKERFRTAFRMKAYAFWQSSED
A
GTGDPMAEDRGYGNDFLIEDMIPTLKAAIRAV
RILQFRLYKKKFKETLRPYDVKDVIEQYSAGHLDMLS
R
IKYLQT
RIDMIFTPGPPSTPKHKKSQKGSAFTYPSQQSPRNEPYVARAATSETEDQSMMGKFVKVERQV
H
DMGKKLDFLVDMHMQHMERLQVHVTEYYPTKGASSPAEGEKKEDNRYSDLKTIICNYSETGPPDPPYSF
H
QVPIDRVGPYGFFAHDPVKLTRGGPSSTKAQANLPSSGSTYAERPTVLPILTLLDSCVSYHSQTELQGP
Y
SDHISPRQRRSITRDSDTPLSLMSVNHEELERSPSGFSISQDRDDYVFGPSGGSSWMREKRYLAEGETD
T
DTDPFTPSGSMPMSSTGDGISDSIWTPSNKPT




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser