NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS49259.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
49259.1 Public Mus musculus 13 Fam120a 21 106 86 CCDS HistoryNCBI Gene:218236Re-query CCDS DB by CCDS ID:49259.1Re-query CCDS DB by GeneID:218236See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 49259.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000060805 ENSMUSP00000053877 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000060805Link to Ensembl Protein Viewer:ENSMUSP00000053877Re-query CCDS DB by Nucleotide ID:ENSMUST00000060805Re-query CCDS DB by Protein ID:ENSMUSP00000053877
Original member NCBI NM_001033268.2 NP_001028440.2 Updated not alive Link to Nucleotide Sequence:NM_001033268.2Link to Protein Sequence:NP_001028440.2Re-query CCDS DB by Nucleotide ID:NM_001033268Re-query CCDS DB by Protein ID:NP_001028440
Current member NCBI NM_001033268.3 NP_001028440.2 Accepted alive Link to Nucleotide Sequence:NM_001033268.3Link to Protein Sequence:NP_001028440.2Re-query CCDS DB by Nucleotide ID:NM_001033268Re-query CCDS DB by Protein ID:NP_001028440Link to BLAST:NP_001028440.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001028440.2 1112 Q6A0A9 1112 100% 0 0

Chromosomal Locations for CCDS 49259.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 48880796 48881095 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 48885273 48885369 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 48885737 48885878 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 48889124 48889261 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 48889755 48889938 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 48891881 48892090 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 48897660 48897774 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 48902058 48902307 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 48910256 48910430 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 48912857 48913084 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 48914862 48914949 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 48921682 48921965 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 48922153 48922250 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 48932297 48932393 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 48933950 48934078 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 48945942 48946024 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 48949057 48949303 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 48967355 48967828 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3339 nt):
ATGGGCGTGCAGGGCTTCCAGGACTACATCGAGAAGCACTGTCCGAGCGCCGTGGTGCCGGTGGAGCTGC
AG
AAGCTGGCCCGGGGCAGCCTGGTGGGCGGCGGGCGGCAGCGGCCCCCGCAGACCCCGCTGCGCCTGCT
G
GTGGATGCCGACAACTGCCTGCATCGCCTGTACGGTGGCTTCTACACCGACTGGGTGAGCGGCGGCCAG
TGG
AACCACATGCTCGGCTACCTGGCGGCTCTGGCCAAGGCCTGCTTCGGAGGCAACATCGAGCTCTTCG
TC
TTCTTCAATGGCGCGCTCGAGAAGGCCCGGCTGCACGAGTGGGTCAAGCGGCAGGGCAACGAGCGCCA
G
ACAGCGCAGCAGATCGTCAGCCATGTCCAGAACAAGGGCACGCCACCGCCCAAGGTCTGGTTCCTGCCT
CCG
GTCTGTATGGCCCACTGCATCCGCCTGGCGCTCATCCGCTTCCACGTCAAGGTTGCACAGAGCATTG
AG
GATCATCATCAAGAAGTGATTGGCTTCTGCAGAGAGAATGGTTTCCATGGCTTGGTGGCATATGACTC
C
GATTATGCACTGTGCAACATCCCCTACTACTTCAGTGCCCATGCCCTGAAACTGAGCCGCAACGGGAAG
AGT
CTCACCACAAGCCAGTATCTGATGCACGAGGTTGCCAAGCAACTGGACCTGAACCCAAATCGTTTTC
CT
ATTTTTGCTGCTCTGTTAGGAAATCACATACTACCTGATGAGGATCTGGCTTCCTTCCATTGGAGTTT
A
CTTGGTCCAGAGCATCCACTCGCCTCACTGAAGGTCCGAGCCCACCAGCTGGTCTTGCCACCCTGTGAT
GTA
GTGATCAAAGCCGTAGCTGATTATGTTCGCAACATTCATGACACGTCTGACCTGGATGCCATAGCTA
AA
GATGTTTTCCAGCATTCACAGTCAAGAACAGATGACAAAGTCATTCGGTTTAAGAGAGCAGTTGGATA
T
TATTCAGCAACTAGCAAGCCCATGCCATTTCACCCACCACATTACTTAGCCCGACCAAATCCATTTGGA
ATG
CCTGGGATGGTGCCACCATATGTTCCCCCTCAGATGCTCAACATTCCACAGACTTCTCTGCAAGCAA
AG
CCCGCGGTCCCGCAGGTGCCCAGCCCAGGGGGCACCCCAGGCCAGGCTCCATACCCATACAGCCTCTC
T
GAGCCAGCCCTCACCCTGGACACTAGCGGGAAGAACCTGACAGAGCAGAATAGCTACAGCAACATTCCT
CAT
GAGGGGAAGCACACACCGCTGTATGAGCGCTCCTCGCCCATCAACCTGGCCCAGAGTGGCAGCCCCA
AT
CACGTGGATTCTGCCTACTTCCCTGGCTCTTCTACATCATCATCATCAGACAATGATGAGGGCGGCGG
A
GGGGCGACCAACCACATCAGCGGGAACAAGATTGGCTGGGAGAAGACAGGAAGCCATGCAGAGCCACTG
GCA
CGGGGAGACCCAGGAGACCAAGTAAAGGTAGAAGGCTCATCCACTGCCTCTTCGGGGAGCCAGCTAG
CT
GAAGGCAAAGGGAGCCATATGGGCACTGTTCAACCAATCCCGTGCCTCCTGTCAATGCCAACTAGGAA
C
CACATGGATATCACCACACCTCCATTGCCCCCTGTCGCACCTGAGGTGTTGAGAGTGGCTGAGCACAGA
CAC
AAGAAGGGACTGATGTACCCCTACATCTTCCATATCCTGACAAAGGGTGAAATCAAAATTGCTGTTT
CT
ATTGAAGATGAAGCCAACAAAGACCTGCCTCCGGCCGCCCTGCTCTATAGGCCAGTTCGTCAGTATGT
T
TACGGAGTCCTGTTTAGTTTGGCAGAAAGCAGAAAGAAAACTGAGAGACTTGCTTTTAGAAAGAACAGA
CTT
CCACCAGAATTCTCGCCACTGATCATTAAGGAGTGGGCAGCTTACAAGGGGAAATCTCCTCAGACCC
CG
GAACTAGTGGAAGCATTGGCCTTCCGGGAGTGGACCTGCCCCAACCTGAAGAGGCTTTGGCTGGGCAA
G
GCGGTGGAGGACAAGAACCGCCGGATGAGGGCCTTCCTGGCCTGCATGAGGTCTGATACCCCAGCCATG
CTC
AACCCTGCCAATGTGCCCACTCACCTCATGGTGCTCTGCTGCGTCTTACGGTATATGGTGCAGTGGC
CT
GGAGCTCGCATTCTGCGAAGGCAGGAGCTGGATGCCTTCCTGGCTCAGGCATTGTCCCCCAAACTCTA
T
GAGCCGGACCAGCTGCAGGAACTCAAGATTGACAACTTAGACCCGAGAGGAATTCAGCTGTCGGCTCTC
TTC
ATGAGTGGAGTAGACATGGCACTGTTTGCTAATGACGCATGTGGACAGCCCATCCCCTGGGAACACT
GT
TGTCCTTGGATGTATTTCGATGGGAAGCTCTTCCAGTCCAAACTTCTTAAAGCCAGCAGGGAGAAGAC
C
CCACTCATCGACCTCTGTGATGGTCAGGCGGAGCAGGCTGCCAAGGTGGAGAAGATGCGCCAGAGCATC
CTG
GAGGGCCTCAGCTTCTCCCGGCAAAACCACCCACTGCCCTTCCCACCGCCTCCTGCTCTGCCCTTCT
AC
CCAGCCTCTGTATACCCTCGGCACTTTGGGCCAGTCCCACCCTCACAGGGCAGGGGCAGGGGCTTTGC
A
GGAGTCTGTGGCTTCGGAGGCCATTATGGGGAAACAGTAGCAACAGGCCCTTACCGTGCCTTCCGGGTG
ACG
GCAGCATCAGGACACTGTGGAGCCTTCTCAGGCAGTGACAGCAGCAGGACTAGCAAGTCCCAGGGCG
GA
GTCCAACCTATTCCTTCTCAGGGAGGGAAGCTAGAAATAGCTGGCACTGTGGTCGGCCACTGGGCTGG
G
AGCAGACGGGGCCGTGGGGGCCGAGGGCCCTTCCCTCTGCAGGTGGTGTCTGTGGGAGGACCAGCGCGA
GG
G
CGTCCAAGGGGTGTTATTTCCACTCCGGTGATTAGAACGTTTGGAAGAGGTGGAAGGTACTACGGCA
GA
GGCTACAAAAGCCAGGGAGCAATTCAGGGCAGGCCTCCTTATGCTGCTTCAGCAGAAGAAGTGGCCAA
A
GAACTGAAGTCGAAATCTGGGGAATCCAAGTCCTCTGCTGTGTCCCTGGCTGAAAACGGAGTGATGGCC
GAG
GAGAAGCCAGTGCCCCAACTTAATGGGAGCACGGGTGACCCCAGAGTCCCCAGCCACTCTGAAAGTG
CC
TTGAATAATGACTCTAAACCGTGCAATACAAATCCTCACTTAAATGCACTAAGTACAGACAGCGCCTG
C
CGCAGGGAGGCTGCTCTGGAGGCAGCTGTCTTAAATAAAGAAGAGTAA


Translation (1112 aa):
MGVQGFQDYIEKHCPSAVVPVELQKLARGSLVGGGRQRPPQTPLRLLVDADNCLHRLYGGFYTDWVSGGQ
W
NHMLGYLAALAKACFGGNIELFVFFNGALEKARLHEWVKRQGNERQTAQQIVSHVQNKGTPPPKVWFLP
P
VCMAHCIRLALIRFHVK
VAQSIEDHHQEVIGFCRENGFHGLVAYDSDYALCNIPYYFSAHALKLSRNGK
S
LTTSQYLMHEVAKQLDLNPNRFPIFAALL
GNHILPDEDLASFHWSLLGPEHPLASLKVRAHQLVLPPCD
V
VIKAVADYVRNIHDTSDLDAIAKDVFQHSQ
SRTDDKVIRFKRAVGYYSATSKPMPFHPPHYLARPNPFG
M
PGMVPPYVPPQMLNIPQTSLQAKPA
VPQVPSPGGTPGQAPYPYSLSEPALTLDTSGKNLTEQNSYSNIP
H
EGKHTPLYERSSPINLAQSGSPNHVDSAYFPGSSTSSSSDNDEGGGGAT
NHISGNKIGWEKTGSHAEPL
A
RGDPGDQVK
VEGSSTASSGSQLAEGKGSHMGTVQPIPCLLSMPTRNHMDITTPPLPPVAPEVLRVAEHR
H
KKGLMYPYIFHILTK
GEIKIAVSIEDEANKDLPPAALLYRPVRQYVYGVLFSLAESRKKTERLAFRKNR
L
PPE
FSPLIIKEWAAYKGKSPQTPELVEALAFREWTCPNLKRLWLGKAVEDKNRRMRAFLACMRSDTPAM
L
NPANVPTHLMVLCCVL
RYMVQWPGARILRRQELDAFLAQALSPKLYEPDQLQELKIDNLDPRGIQLSAL
F
MSGVDMALFANDACGQPIPWEHCCPWMYFDGKLFQSKLLKASREKTPLIDLCDGQ
AEQAAKVEKMRQSI
L
EGLSFSRQNHPLPFPPPPALPFYPASVYPRHFGPVPPSQGRGRGFA
GVCGFGGHYGETVATGPYRAFRV
T
AASGHCGAFSGSDSSRTSKSQG
GVQPIPSQGGKLEIAGTVVGHWAGSRRGRGGRGPFPLQVVSVGGPAR
G
RPRGVISTPVIRTFGRGGRYYGRGYKSQGAIQGRPPYAASAEEVAKELKSKSGESKSSAVSLAENGVMA
E
EKPVPQLNGSTGDPRVPSHSESALNNDSKPCNTNPHLNALSTDSACRREAALEAAVLNKEE




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser