NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS49149.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
49149.2 Public Mus musculus 12 Unc79 23 108 98 CCDS HistoryNCBI Gene:217843Re-query CCDS DB by CCDS ID:49149.2Re-query CCDS DB by GeneID:217843See the combined annotation on chromosome 12 in Sequence Viewer

Public Note for CCDS 49149.1
The coding region has been updated to extend the N-terminus to one that is more supported by available transcript and conservation data. The update changes the protein length from 2458 aa to 2596 aa.

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 49149.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000101099.11 ENSMUSP00000098659.5 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000101099.11Link to Ensembl Protein Viewer:ENSMUSP00000098659.5Re-query CCDS DB by Nucleotide ID:ENSMUST00000101099Re-query CCDS DB by Protein ID:ENSMUSP00000098659
Original member Current member NCBI NM_001081017.2 NP_001074486.2 Accepted alive Link to Nucleotide Sequence:NM_001081017.2Link to Protein Sequence:NP_001074486.2Re-query CCDS DB by Nucleotide ID:NM_001081017Re-query CCDS DB by Protein ID:NP_001074486Link to BLAST:NP_001074486.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001074486.2 2596 Q0KK59 2596 100% 0 0

Chromosomal Locations for CCDS 49149.2

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome 12 (NC_000078.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 102949554 102949575 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 102991350 102991470 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 102998438 102998742 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103001806 103001976 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103011200 103011292 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103021007 103021062 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103021747 103021876 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103042115 103042179 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103046956 103047044 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103047658 103047698 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103049895 103049923 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103059319 103059548 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103061345 103061516 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103063105 103063335 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103070018 103070208 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103070742 103070865 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103072660 103072800 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103074762 103074983 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103078841 103079068 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103083498 103083639 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103088449 103088528 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103088623 103088771 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103092014 103092171 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103092630 103092811 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103094192 103094393 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103094958 103095137 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103104609 103104895 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103108116 103108298 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103108616 103108778 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103112022 103113242 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103122336 103122443 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103128229 103128312 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103131556 103131658 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103134405 103134545 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103135670 103135708 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103141772 103141884 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103141979 103142064 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103142587 103142760 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103146302 103146370 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103148971 103149081 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103156456 103156560 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103161813 103161890 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103165630 103165719 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103168275 103168450 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103169567 103169753 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103171572 103171769 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103173453 103173530 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103182163 103182204 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 103183413 103183613 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (7791 nt):
ATGTCCACCAAAGCGGAGCAGTTTGCTTCCAAGATCCGGTACTTGCAGGAATATCATAACCGAGTTCTCC
AC
AACATTTATCCCGTACCATCAGGAACAGATATTGCAAACACCCTGAAGTACTTTTCTCAGACCTTGTT
A
AGCATTTTGTCCCGCACAGGGAAGAAGGAAAACCAAGATGCCTCCAATTTGACAGTGCCCATGACCATG
TGT
CTTTTTCCCGTGCCATTCCCACTCACCCCATCTCTAAGACCGCAGGTCAGTTCCATCAACCCTACTG
TT
ACTCGCTCCCTCCTTTACAGCGTCCTGCGAGATGCTCCTTCAGAACGCGGCCCGCAAAGTCGTGATGC
T
CAGTTGTCAGACTACCCTTCTTTGGACTACCAAGGCCTCTACGTGACTTTGGTGACTCTCCTGGATCTA
GTT
CCTTTACTACAGCATGGCCAACATGATCTTGGACAGTCAATATTTTATACGACCACGTGTTTGCTCC
CC
TTTCTCAATGATGATGTTCTGAGCACTTTGCCCTACACGATGATCTCAACGCTAGCCACCTTCCCTCC
A
TTTCTTCACAAGGATATTATTGAATATCTTAGCACATCTTTTCTACCAATGGCTATATTGGGTTCCTCC
GGG
AGAGAAGGCGTTCCGGCCCATGTTAACCTCTCTGCGTCCTCAATGCTAATGATCGCAATGCAGTACA
CC
TCTAACCCAGTGTATCATTGTCAATTATTGGAATGCCTCATGAAGTATAAACAAGAAGTCTGGAAAGA
C
CTTTTGTATGTGATTGCCTACGGGCCTTCACAGGTGAAGCCTCCAGCAGTACAGATGCTTTTCCACTAT
TGG
CCCAACCTGAAGCCTCCCGGAGCAATAAGCGAGTACAGGGGCTTACAGTACACAGCTTGGAATCCCA
TC
CACTGCCAGCATATCGAATGTCACAATGCAATCAACAAGCCGGCTGTGAAGATGTGTATAGACCCGTC
C
TTGTCCGTAGCTTTGGGTGATAAGCCACCTCCACTGTATCTCTGTGAGGAATGCAGCGAGAGGATTTCA
GG
G
GACCACAGCGAGTGGTTGATTGATGTTCTCCTGCCACAAGCTGAAATATCTGCTATATGTCAGAAAA
AG
AACTGCAGCTCCCATGTCAGAAGGGCAGTGGTCACCTGCTTTTCCGCAGGGTGCTGCGGTCGCCACGG
A
AACAGGCCTGTTCGGTACTGCAAAAGGTGCCACTCGAACCACCACAGTAACGAGGTGGGAGCCACCGCA
GAA
ACTCACCTCTACCAGACCTCTCCACCCCCCATCAACACCAGGGAGTGTGGGGCGGAGGAGCTGGTCT
GT
GCTGTGGAGGCAGTGATCAGCTTGTTGAAAGAAGCAGAGTTCCACGCAGAGCAGAGGGAGCACGAGTT
G
AACCGGCGGCGGCAGCTGGGCCTCTCGTCCTCCCACCACTCCCTGGACAACACTGATTTTGATAACAAA
GAT
GATGACAAGCACGACCAGAGGCTGCTCAGCCAATTCGGGATATGGTTCTTAGTGAGCCTCTGCACAC
CC
AGCGAGAACACGCCCACAGAGAGCCTGGCCCGGCTGGTGGCTATGGTATTTCAGTGGTTTCATTCCAC
G
GCGTACATGATGGATGATGAAGTTGGAAGCTTGGTGGAAAAGCTGAAGCCCCAGTTTGTCACCAAGTGG
TTG
AAGACAGTATGTGATGTCCGATTTGATGTCATGGTCATGTGCCTTCTTCCCAAACCCATGGAATTTG
CC
AGGGTCGGTGGGTACTGGGACAAGTCCTGTAGCACGGTGACTCAGTTAAAGGAAGGTCTCAACAGGAT
C
CTCTGCCTGATCCCTTACAATGTCATCAGCCAGTCTGTGTGGGAGTGCATTATGCCTGAATGGCTGGAA
GCC
ATCCGGACAGAAGTCCCTGACAACCAGTTAAAGGAATTCAGGGAAGTATTAAGCAAAATGTTTGACA
TA
GAGCTGTGCCCTCTGCCGTTTTCAATGGAAGAGATGTTTGGTTTTATTAGCTGTCGGTTTACAGGATA
T
CCCTCCACTGTGCAGGAGCAAGCGCTACTCTGGCTTCACGTGTTATCGGAGTTAGATATCACGGTTCCA
CTC
CAACTCTTGATAAGTATGTTTTCTGATGGTGTTAATTCTGTCAAAGAATTGGCAAATCAAAGAAAAT
CA
AGAGCCAATGAACTGGCGGGGAACCTCGCATCTCGAAGGGTGAGTGTCGCCTCTGATCCTGGTCGACG
A
GGTCAGCACAATACGTTGAGTCCATTTCATAGCCCTTTCCAGAGTCCGTTCCGGAGTCCCATGCGTAGT
CCA
TTCCGTAGCCCCTTCAAGAACTTTGGACACCCAGGAGGAAGGACTATTGATTTTGATTGTGAAGATG
AT
GACATGAATCTAAATTGTTTCATCCTCATGTTTGACCTTCTCCTAAAGCAGATGGAGCTACAAGATGA
C
GGCATCACGATGGGTTTAGAGCACAGTTTGTCCAAGGACATTATTTCTATCATAAACAATGTCTTCCAG
GCC
CCCTGGGGGGGCTCCCACAGCTGCCAGAAGGACAAAAAGGCAACGGAGTGTAACTTGTGTCAGTCTA
GC
ATCCTCTGCTACCAGCTCGCCTGTGAACTCCTGGAGAGACTAGCTCCCAAAGAAGAAAGCCGGCTGGT
G
GAGCCCACAGACAGCCTTGAAGATAGCCTCCTTTCTTCCAGACCAGAGTTCATTTTAGGCCCTGAAGGA
GAG
GAGGAGGAGAACCCAGCAGCCAAACATGGAGAGAATCCAGGCAACCGTACAGTGCCCTCAGAACATG
CT
GCAATAAAGAATGACACGGAAAGAAAATTTTGCTACCAACAGCTTCCAGTTACATTGAGACTAATATA
T
ACCATTTTCCAGGAAATGGCGAAGTTTGAAGAGCCAGATATTCTTTTTAATATGCTCAACTGCCTGAAG
ATT
CTCTGTCTGCACGGAGAGTGTCTGTACACGGCGAGGAAAGACCATCCTCAATTTTTAGCCTACATTC
AG
GACCACATGTTGATTGCAAGCCTCTGGAGAGTCGTCAAATCTGAGTTCTCTCAGCTGTCTTCACTGGC
A
GTTCCTCTCCTTCTTCACGCTCTGTCCCTTCCTCATGGTGCTGACATATTCTGGACAATCATAAATGGC
AAC
TTCAACAGCAAAGACTGGAAGATGAGGTTTGAAGCAGTGGAAAAAGTAGCTGTCATTTGTAGGTTTT
TG
GATATTCACTCAGTGACCAAAAACCACCTGCTGAAGTACTCTCTGGCACACGCTTTCTGCTGCTTCCT
G
ACAGCTGTGGAGGATGTCAATCCCGCAGTAGCCACCAGAGCAGGTCTCCTCCTTGACACCATAAAGAGG
CCA
GCACTGCAGGGCCTTTGTCTTTGCCTTGACTTCCAGTTCGACACTGTGGTTAAAGACCGACCCACCA
TC
CTGAGCAAGCTTTTACTCTTGCATTTTCTTAAGCAAGACATTCCTGCTTTGAGCTGGGAGTTCTTTGT
T
AACAGATTTGAGACACTTTCTTTGGAAGCTCAGCTGCATCTAGATTGTAACAAAGAATTTCCTTTTCCT
ACA
ACCATCACTGCTGTGAGAACCAATGTTGCCAACCTCAGTGATGCTGCCTTGTGGAAGATCAAGAGAG
CA
CGTTTTGCAAGAAACAGACAGAAGAGTGTGCGGTCCCTGAGAGACAGTGTGAAAGGGCCCGCCGAATC
C
AAGAGGGCGCTCTCCCTCCCTGAGACCCTGACCTCCAAAATCCGACAACAGTCTCCAGAAAACGACAAC
ACC
ATCAAGGACCTGCTCCCAGAAGATGCTGGCATTGATCACCAGACCGTTCACCAGCTGATCACAGTGC
TC
ATGAAGTTCATGGCCAGGGATGAAAGCAGTGCGGAGTCAGATATCAGCAGCGCAAAGGCCTTCAACAC
A
GTCAAGAGGCACCTCTATGTTTTACTTGGCTATGACCAGCAGGAAGGATGCTTCATGATCGCACCCCAA
AAA
ATGCGCCTGTCAACATGCTTTAATGCATTTATTGCAGGAATTGCCCAAGTTATGGACTATAACATTA
AC
TTGGGCAAACACCTTCTCCCCCTCGTGGTTCAGGTGCTCAAATACTGCTCTTGTCCTCAACTCCGGCA
T
TATTTCCAACAGCCACCTCGCTGCTCCCTCTGGTCCCTAAAGCCTCACATCAGGCAGATGTGGTTGAAG
GCC
TTGCTCGTCATCCTTTACAAGTATCCGTACAGAGACTGTGATGTCAGCAAGACCCTGCTGCACCTGA
TT
CACATAACAGTGAATACACTCAATGCGCAGTACCATAGCTGCAAGCCCCACGCCACGGCAGGACCGCT
G
TACACTGACAACAGCAACATAAGCAGATACAGCGAGAAGGAGAAAGGTGAAATAGAACTGGCCGAATAT
AGA
GAAACGGGTGCGTTACAAGACAGCGTTCTACACTGTGTGAGAGAAGAAAGCATTCAGAAAAAAAAGC
TA
CGCTCTTTAAAACAAAAATCTCTTGATATAGGGAATGCAGACTCCCTCTTGTTTACATTAGATGAGCA
T
CGTAGGAAGTCCTGCATAGATCGATGTGACATAGATAAACCTCCTGCCCAAGCTGCTTATATCTCACAA
CGG
CAAAACGACCACCATGGACGGTCTAGACAGAATTCTGCGACGAGGCCCGACAATACTGAAATCCCCA
AG
AATCCAGGCACCGAAGGTTTTCAAGAAATTCGAAGGCCGGTGATACCAGAGGTTAGGTTGAACTGCAT
G
GAGACGTTTGAAGTGAGAGTTGATTCCCCAGGAAAGCCTGCTCCTAGGGAGGATTTAGATCTGATAGAT
CTG
TCCTCAGACTCAACATCTGGGCCAGAGAAACACTCTATACTGTCCACATCCGACAGTGACTCTCTGG
TG
TTTGAGCCTCTCCCACCTCTCAGAATAGTCGAAAGTGATGAAGAAGAAGAGATGATGAACCAAGGGAA
T
GGTGGTGCCTTGGGTAACAATGCTGCCTCCTCCCCCTCCATCCCCAGCCAGCCCTCTGTCCTCAGCCTG
AGC
ACAACTCCTCTTGTGCAGGTGAGTGTAGAGGATTGCTCCAAAGACTTTTCTTCCAAGGACTCAGGAA
AC
CACCAGTCGGCGAGCAATGAAGATTCTACTATCGCAGCTCTGGACGACCTCACGGACTCTGAAGAGCT
G
TCAAAGTCAGAGGAGCTGAGAGAGTTTGCCTCTGGCAGTCCGCTAACGCTCAAGCAAAAACGAGACCTC
CTT
CAGAAGTCGTCTGCCGTCCCTGAGATGTCAGTGGACTATAACCCCGAACCCAGCCCGGCTGAAGAAA
AG
CCAGGGCAGACGCCAACATCAGGGGTCAAAACTGTGCTCCTCAAAGTTCCCGAAGATGGTGAGAATCT
T
ATAGAGAGCGAGAAACCCAACACCAGTGCCGAGTCTGACACAGAACAGAACCCTGAAAGGAAGGTAGAG
GAG
GATGGAGCCGAGGAATCAGAATTTAAGATTCAGATCGTCCCCAGGCAGAGGAAACAAAGGAAGATTG
CC
GTCAGCGCTATCCAGAGAGAGTACCTTGACATCTCCTTCAACATCCTAGACAAACTGGGTGAACAGAA
G
GACCCAGATCCCTCTGCTAAAGGACTTTCAACGTTGGAAATGCCACGGGAATCTTCCTCTGCCCCTACG
TTA
GAAGCAGGTGCCCCTGAAACCAGCAGTCACTCATCAATATCAAAACAGATACAGCCCGGGAAGCGGC
AG
TGTAACGTGCCAATGTGCCTAAACCCTGACCTGGAGGGACAGCCATTGAGGACAAGAGGTGCCACGAA
A
TCCAGCCTGCTGTCAGCACCCAGCATAGCCAGCATGTTCGTGCCTGCACCTGAAGAATTCACAGAGGAG
CAG
CCAACCGTGATGGCCGACAAATGCCATGACTGTGGGGCCATTCTGGAGGAATATGACGAGGAGACCC
TC
GGGCTAGCCATCGTGGTCCTCTCCACGTTCATTCACCTAAGCCCAGACTTGGCGGCGCCGCTGTTGCT
T
GATATCATGCAGTCTGTGGGAAGGCTCGCATCCAGCACTACCTTTTCTAATCAAGCAGAAAGCATGATG
GTT
CCAGGCAATGCAGCAGGTGTGGCCAAGCAGTTCCTGCGCTGCATCTTCCATCAGCTGGCCCCCAATG
GC
ATCTTCCCTCAGCTCTTCCAGAGTGCCATCAAAGATGGGACTTTTTTAAGGACCTTAGCCACATCTCT
C
ATGGACTTCAACGAGCTGAGCTCAATTGCTGCCCTCAGTCAGCTCTTGGAGGGTCTAAATAACAAAAAG
AAT
TTACCAGCAGGGGGTGCTATGATACGCTGTTTGGAAAACATTGCCACGTTCATGGAAGCTCTGCCCA
TG
GATTCTCCTAGTAGTCTCTGGACCACAATCAGCAACCAGTTTCAGACATTTTTTGCCAAGCTGCCTTG
T
GTTTTACCTCTGAAGTGTTCTTTAGATTCCAGTTTGAGAATTATGATTTGCCTCTTGAAGATACCTTCC
ACC
AATGCCACGAGGAGTTTGTTGGAGCCATTTTCCAAGCTACTGAGCTTTGTCATTCAGAATGCAGTCT
TC
ACGCTGGCCTACCTCGTGGAGTTGTGTGGTTTGTGCTACCGAGCGTTCACAAAGGAGAGGGATAAGTT
C
TACTTGTCTCGGAGTGTTGTTCTGGAACTTCTACAGGCCCTGAAGCTCAAGTCACCTTTGCCAGACACA
AAC
CTCCTGCTGCTTGTCCAGTTTATCTGTGCAGATGCTGGAACCAAGCTAGCTGAGTCTACCATCCTAA
GC
AAGCAGATGATCGCCTCTGTGCCCGGGTGTGGGACGGCAGCAATGGAGTGCATACGGCAGTACGTCAG
T
GAGGTGCTGGAATTCATGGCTGACATGCACACACTAACCAAGCTCAAGAGCCACATGAAGACGTGCTCC
CAG
CCTCTGCACGAGGATACCTTCGGAGGCCATCTCAAAGTTGGCCTAGCTCAGATTGCAGCTATGGAAA
TC
TCCCGGGGCAACCACAGAGATAACAAAGCCGTGATCCGATATCTGCCTTGGCTCTACCATCCTCCCTC
T
GCAATGCAGCAAGGACCTAAAGAATTCATCGAGTGTGTCTCCCACATCCGGTTGCTGTCCTGGCTGCTT
CTG
GGATCCCTCACGCATAATGCAGTCTGTCCCAACGCCTCCTCTCCATGCCTTCCCATACCTCTGGATG
CA
GGTTCCCACATTGCAGACCACCTTATTGTTATCCTAATTGGATTTCCAGAGCAATCAAAGACCTGCGT
G
CTCCACATGTGCTCCCTCTTCCACGCGTTCATCTTTGCCCAGCTCTGGACGGTCTACTGCGAACAGAGT
GCC
GTGGCGACGAACGTCCAAAATCAGAACGAATTCAGCTTCACAGCAATACTAACAGCACTGGAATTCT
GG
AGCAGGGTGACACCGAGCATCCTTCAACTGATGGCCCACAATAAAGTGATGGTAGAAATGGTGTGTCT
C
CATGTGATTAGTTTAATGGAGGCGTTGCAAGAATGCAATTCAACCATTTTTGTCAAGCTGATCCCTATG
TGG
TTACCAATGATTCAGTCCAATACCAAGCACTTATCCGCTGGCCTCCAGCTTCGTCTCCAGGCCATTC
AG
AACAACGTGAACCACCACAGCCTAAGGACGCTGCCCGGCTCGGGCCAGAGCAGTGCTGGCCTAGCAGC
C
CTCCGGAAATGGCTGCAGTGCACCCAGTTCAAAATGGCCCAGGTGGAGATCCAGTCCTCGGAAGCAGCG
TCT
CAATTTTATCCTCTATGA


Translation (2596 aa):
MSTKAEQFASKIRYLQEYHNRVLHNIYPVPSGTDIANTLKYFSQTLLSILSRTGKKENQDASNLTVPMTM
C
LFPVPFPLTPSLRPQVSSINPTVTRSLLYSVLRDAPSERGPQSRDAQLSDYPSLDYQGLYVTLVTLLDL
V
PLLQHGQH
DLGQSIFYTTTCLLPFLNDDVLSTLPYTMISTLATFPPFLHKDIIEYLSTSFLPMAILGSS
G
REGVPAHVNLSASSMLMIAMQYTSNP
VYHCQLLECLMKYKQEVWKDLLYVIAYGPSQVKPPAVQMLFHY
W
PNLKPPGAISEYRGLQYT
AWNPIHCQHIECHNAINKPAVKMCIDPSLSVALGDKPPPLYLCEECSERIS
G
DHSEWLIDVLLPQAEISAICQKKNCSSHVRRAVVTCFSAGCCGRHGNRPVRYCKRCHSNHHSNEVGATA
E
THLYQTSPPPINTRECGAEELVCAVEAVI
SLLKEAEFHAEQREHELNRRRQLGLSSSHHSLDNTDFDNK
D
DDKHDQRLLSQFGIWFL
VSLCTPSENTPTESLARLVAMVFQWFHSTAYMMDDEVGSLVEKLKPQFVTKW
L
KTVCDVRFDVMVMCLLPKPMEFAR
VGGYWDKSCSTVTQLKEGLNRILCLIPYNVISQSVWECIMPEWLE
A
IRTEVPDNQLKEFREVL
SKMFDIELCPLPFSMEEMFGFISCRFTGYPSTVQEQALLWLHVLSELDITVP
L
QLLISMFSDGVNSVKELANQRKSRANELAGNLASRR
VSVASDPGRRGQHNTLSPFHSPFQSPFRSPMRS
P
FRSPFKNFGHPGGRTIDFDCEDDDMNLNCFILMFDLLLKQ
MELQDDGITMGLEHSLSKDIISIINNVFQ
A
PWGGSHSCQKDKKATECNLCQSSILCYQLACELLERLAPKEESRLV
EPTDSLEDSLLSSRPEFILGPEG
E
EEENPAAKHGENPGNRTVPSEHA
AIKNDTERKFCYQQLPVTLRLIYTIFQEMAKFEEPDILFNMLNCLK
I
LCLHGECLYTARKDHPQFLAYIQDHMLIA
SLWRVVKSEFSQLSSLAVPLLLHALSLPHGADIFWTIING
N
FNSKDWKMRFEA
VEKVAVICRFLDIHSVTKNHLLKYSLAHAFCCFLTAVEDVNPAVATRAGLLLDTIKR
P
ALQ
GLCLCLDFQFDTVVKDRPTILSKLLLLHFLKQDIPALSWEFFVNRFETLSLEAQLHLDCNKEFPFP
T
TITAVRTNVANLSDAALWKIKRARFARNRQKSVRSLRDSVKGPAESKRALSLPETLTSKIRQQSPENDN
T
IKDLLPEDAGIDHQTVHQLITVLMKFMARDESSAESDISSAKAFNTVKRHLYVLLGYDQQEGCFMIAPQ
K
MRLSTCFNAFIAGIAQ
VMDYNINLGKHLLPLVVQVLKYCSCPQLRHYFQQPPRCSLWSLKPHIRQMWLK
A
LLVILYK
YPYRDCDVSKTLLHLIHITVNTLNAQYHSCKPHATAGPLYTDNSNISRYSEKEKGEIELAEY
R
ETGALQDSVLHCVREESIQKKKLRSLKQKSLDIGNADSLLFTLDEHRRKSCIDRCDIDKPPAQAAYISQ
R
QNDHHGRSRQNSATRPDNTEIPKNPGTEGFQEIRRPVIPEVRLNCMETFEVRVDSPGKPAPREDLDLID
L
SSDSTSGPEKHSILSTSDSDSLVFEPLPPLRIVESDEEEEMMNQGNGGALGNNAASSPSIPSQPSVLSL
S
TTPLVQVSVEDCSKDFSSKDSGNHQSASNEDSTIAALDDLTDSEELSKSEELREFASGSPLTLKQKRDL
L
QKSSAVPEMSVDYNPEPSPAEEKPGQTPTSGVKTVLLKVPEDGENLIESEKPNTSAESDTEQNPERKVE
E
DGAEESEFKIQIVPRQRKQRKIAVSAIQREYLDISFNILDKLGEQKDP
DPSAKGLSTLEMPRESSSAPT
L
EAGAPETSSHSSIS
KQIQPGKRQCNVPMCLNPDLEGQPLRTRGATKSSLLSAPSIASMFVPAPEEFTEE
Q
PTVMAD
KCHDCGAILEEYDEETLGLAIVVLSTFIHLSPDLAAPLLLDIMQSVGRLASSTTFSNQAESMM
V
PGNAAGVAKQFLRCIFHQLAPNGIFPQLFQSAIK
DGTFLRTLATSLMDFNELSSIAALSQLLEGLNNKK
N
LPAGGAMIRCLENIATFMEALPMDSPSSLWTTISNQFQTFFAKLPCVLPLK
CSLDSSLRIMICLLKIPS
T
NATR
SLLEPFSKLLSFVIQNAVFTLAYLVELCGLCYRAFTKERDKFYLSRSVVLELLQALKLKSPLPDT
N
LLLLVQ
FICADAGTKLAESTILSKQMIASVPGCGTAAMECIRQYVSEVLEFMADMHTLTKLKSHMKTCS
Q
PLHEDTFGGHLKVGLAQIAAMEISRGNHRDNKAVIRYLPWLYHPPSAMQQ
GPKEFIECVSHIRLLSWLL
L
GSLTHNAVCPNASSPCLPIPLDAGSHIADHLIVILIGFPEQSK
TCVLHMCSLFHAFIFAQLWTVYCEQS
A
VATNVQNQNEFSFTAILTALEFWSRVTPSILQLMAHNKV
MVEMVCLHVISLMEALQECNSTIFVKLIPM
W
LPMIQSNTK
HLSAGLQLRLQAIQNNVNHHSLRTLPGSGQSSAGLAALRKWLQCTQFKMAQVEIQSSEAA
S
QFYPL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser