NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS49109.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
49109.1 Public Mus musculus 12 Elmsan1 21 106 86 CCDS HistoryNCBI Gene:238317Re-query CCDS DB by CCDS ID:49109.1Re-query CCDS DB by GeneID:238317See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 49109.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000046266 ENSMUSP00000048120 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000046266Link to Ensembl Protein Viewer:ENSMUSP00000048120Re-query CCDS DB by Nucleotide ID:ENSMUST00000046266Re-query CCDS DB by Protein ID:ENSMUSP00000048120
Original member Current member EBI,WTSI ENSMUST00000110294 ENSMUSP00000105923 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000110294Link to Ensembl Protein Viewer:ENSMUSP00000105923Re-query CCDS DB by Nucleotide ID:ENSMUST00000110294Re-query CCDS DB by Protein ID:ENSMUSP00000105923
Original member Current member EBI,WTSI OTTMUST00000042302 OTTMUSP00000019006 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000042302Link to Vega Protein Viewer:OTTMUSP00000019006Re-query CCDS DB by Nucleotide ID:OTTMUST00000042302Re-query CCDS DB by Protein ID:OTTMUSP00000019006
Original member Current member NCBI NM_001163501.1 NP_001156973.1 Accepted alive Link to Nucleotide Sequence:NM_001163501.1Link to Protein Sequence:NP_001156973.1Re-query CCDS DB by Nucleotide ID:NM_001163501Re-query CCDS DB by Protein ID:NP_001156973Link to BLAST:NP_001156973.1
Original member Current member NCBI NM_001163502.1 NP_001156974.1 Accepted alive Link to Nucleotide Sequence:NM_001163502.1Link to Protein Sequence:NP_001156974.1Re-query CCDS DB by Nucleotide ID:NM_001163502Re-query CCDS DB by Protein ID:NP_001156974Link to BLAST:NP_001156974.1

Chromosomal Locations for CCDS 49109.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 12 (NC_000078.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 84152402 84152561 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 84152835 84153031 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 84154895 84155107 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 84156427 84156576 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 84158255 84158343 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 84158976 84159051 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 84159650 84159753 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 84159875 84160017 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 84160479 84160545 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 84162256 84162601 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 84171460 84171759 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 84172754 84174178 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3270 nt):
ATGAACCTCCAGGCCCAGTCCAAGGCTCAGAGTAAACGCAAGCGTTGTCCTTTTGGGGACCAGGAGCCAG
CC
GCCAAGGAACAGCCACCACCACTGCAGAGTCCACCACAGTCCCTCAGAGCTAAGGAGGAACAGTACGG
G
GCCCACGAAGGTCCCACAGGGGTGGCCTCCACCACCCAGCCTGTGGAGCTGTCTCCTCCTAACAACCTG
GCT
CTCCTGAACAGTGTGGTGTATGGATCTGAGAGGACCACGGCAGCCATGTTGTCCCAGCAGGCCCAAG
TA
AGCTCGGTAAAGTGGCCCAGCTCTGTGATGGCTCCAGGGCGGGGCCTGGAACGTGGCGGAGGTGGAGG
C
ATCAGTGACAGTGGCTGGCAGCAGCAACCTGGCCAGCCCCCACCCCACTCCACGTGGAATCACCTGCCC
CTC
TACGGTGGACCCAAAGGGAGCCCTCATCCAGGTGTGGGGGTACCTCCCTACTATAACCACCCGGAGG
CA
CTGAAGGGGAACAAACCTGGAGGTCCCCAGCTGGATCACTATGGAAACGCAGTGCAGCCCATGGTGCC
A
CAGAAGGTGCAGCTGGAGGTGGGGAGGCCCCAAGCACCCTTGAACTCTTTCCATGCAGCCAAGAAACCC
CCA
AACCAGACACTGCCCTTGCAACCCTTCCAGCTGGCATTTGGCCACCAGGTGAACCGTCAGGTCTTCC
GG
CAGGGCCCTCAGCCCTCTAACCCCACCGCCTCCTTCCCACCTCAGAAGCAGCAGCAGCAACAGCAACC
G
GCAGCCCTGCCCCAGATGCAGCTATTTGAGAACTACTACCCCATGCATCAACTGCCTTCGCAACAGCAC
CAG
GACTTTGGCCTGGCACCAGGTGGGCCACTGGGACAGACCCACCTGGCTCACCGCAGCATGGCCCCTT
AC
CCCTTTTCCCACAACCCAGATATGAACCCAGAACTGCGCAAGGCTCTCCTGCAGGACCCTGCTTCACA
G
CCCGTGCTACCTCAGCCCCAGATGGCCTTCCCACGTCGCTCCCGCCGTCTCTCCAAGGAGGGAATTCTG
CCT
TCCAACTCCCTCGATGGAGCTGGCACCCAACCTGGGCAGGAGCCCGCGAGCAATCTGTTCCTTCACC
AC
TGGTCTCTGCCGCAGCCACCGCCAGGCACCCTGGGGCAGCCCCATTCTGAAGCCCTGGGATTCCCGTT
A
GAACTGAGGGAGTCACAGATGCTGGCGGATGGGGACAGACTGGCACCCAATGGTCGGGAGCGGGAGCCT
CCC
GCCATGGGTAATGAGGAGGTCATGAGAGCAGGGGGCCTCGGGGACTGTGGACAGATGATACGAAGTG
GG
GTGATCCAGAGCACAAAACGGAGACGCAGGGTGTCCCAGGAGGCTAATTTGCTGACCCTGGCCCAGAA
G
GCAGTGGAGCTGGCCTCTATGCAGGATGCCAATGGCTCTGAGGAGAAGCGGAAAAGCGTGTTGGCCACA
ACT
TCCAGGTGTGGCGTGGAGTTTTCCGAGCCTGCCTTAGCCGCCAAGAGAGCTCGGGAGGAGAGTGGGA
TG
GTACCCCTCATCATTCCTGTGTCTGTTCCCGTGAGGACTGTGGGTCCAACTGAGGTGGCCCAAGTCGG
A
GGTGCTGACGAGGATGGGACTGGTCTTGAGCAGTACCCCACCGAGCACAAGCCGTCAGTCATCGTGACC
CGC
AGGCGGTCCACCCGAGTTCCCGGGACAGATGCTGCAGCTCAGGCTGAAGACCTGAACGTCAAGTTGG
AA
GGGGAGCCTTCCATGCGGAAACCAAAGCAGCGGCCGCGGCCGGAGCCCCTCATCATCCCCACCAAGGC
G
GGCACTTTCATCGCCCCTCCTGTCTACTCCAACATCACCCCTTACCAGAGCCACCTGCGCTCTCCCGTG
CGC
CTTGCTGACCACCCCTCTGAGCGGAGCTTTGAGCCCCCCCCTTACACACCACCCCCCATTCTCAGCC
CC
GTCCGGGAAGGCTCTGGCCTCTACTTCAATGCCATCATATCAACCAGCAACATCCCGGCCCCTCCTCC
T
ATCACGCCAAAGAGTGCCCATCGAACCCTGCTCCGCTCTAATAGCTCTGAAGTCACCCCGCCTGTCCTC
TCT
GTGATGGGGGAGGCCACCCCTGTGAGCATCGAACCACGAATCAACGTCGGGACCCGGTTCCAGGCAG
AA
ATCCCCATGATGAGAGACCGAGCGCTGGCAGCTTTTGACCCCCATAAGGCTGACTTGGTGTGGCAGCC
A
TGGGAACATCTTGAGAGCAGCTGGGAGAAGCAGAGACAAGTGGATGACCTGCTGACAGCTGCCTGTTCA
AGC
ATTTTCCCTGGGGCCGGCACCAACCAGGAGCTGGCCCTGCACTATCTGCATGAGTCCCGGGGGGACA
TC
CTGGAGGCGCTGAATAAGCTGCTACTGAGGAAGCCCCTGCGGCCTCACAATCACCCACTGGCGACATA
T
CACTACACAGGCTCTGACCAGTGGAAGACGGCTGAGAGGAAGCTGTTCAACAAGGGCATTGCCATCTAT
AAG
AAAGATTTCTTCCTGGTGCAGAAGCTGATCCAGACCAAGACTGTGGCCCAGTGCGTGGAATTCTACT
AC
ACCTACAAGAAACAGGTGAAAATCGGCCGCAACGGGACGCTCACCTTCGGCGACCTGGATATCGGTGA
C
GAGAAGTCAGGCCAAGAGGAGGTTGAGGTGGACGTTAAGACTTCTCAGAAGTTCCCAAGGGTGCCTCCT
CCC
AGAAGAGAGTCCCCAAGTGAAGAGAGGCTGGAGCCTAAGAGAGAAGTGACAGAACCCAGGAAGGAGG
GG
GAGGAGGAGGTGCCAGACACCCAGGAGAAGGGAGAGCAGGAGGAGGGGCGTGAGCGCTGCCGGCGGGC
C
GCTGCCGTCAAAGCTACACAGACACTACAGGCCAATGAGGCGGCCAATGACGTTCTCATTCTCCGGAGC
CAT
GAGCCCAACGCCCCGGGGTCTGCAGGTATCCAGACCTCAGAGAAGCCGAGGGAGGGGCCGGGGAAGT
CC
CGAAGGGCACTGCCTTTCACAGAGAAGAAGAAAAAAGCCGAGGCATTTAATAAAACCCAGAACCAGGA
G
AACACCTTCCCTTGTAAAAAGTGCGGCAGGGTGTTTTACAAGGTGAAGAGCCGCAGTGCTCACATGAAG
AGT
CACGCAGAGCAAGAGAAGAAGGCCGCAGCTCTGAGGCTGAAGGAGAAGGAGGCTGCAGCGGCCGCCG
CA
CATCAGCAGGCGCTGAGAGAAGAGAGCGGCGAAGGGGAGAAGGGCTGA


Translation (1089 aa):
MNLQAQSKAQSKRKRCPFGDQEPAAKEQPPPLQSPPQSLRAKEEQYGAHEGPTGVASTTQPVELSPPNNL
A
LLNSVVYGSERTTAAMLSQQAQVSSVKWPSSVMAPGRGLERGGGGGISDSGWQQQPGQPPPHSTWNHLP
L
YGGPKGSPHPGVGVPPYYNHPEALKGNKPGGPQLDHYGNAVQPMVPQKVQLEVGRPQAPLNSFHAAKKP
P
NQTLPLQPFQLAFGHQVNRQVFRQGPQPSNPTASFPPQKQQQQQQPAALPQMQLFENYYPMHQLPSQQH
Q
DFGLAPGGPLGQTHLAHRSMAPYPFSHNPDMNPELRKALLQDPASQPVLPQPQMAFPRRSRRLSKEGIL
P
SNSLDGAGTQPGQEPASNLFLHHWSLPQPPPGTLGQPHSEALGFPLELRESQMLADGDRLAPNGREREP
P
AMGNEEVMRAGGLGDCGQMIRSGVIQSTKRRRRVSQEANLLTLAQKAVELASMQ
DANGSEEKRKSVLAT
T
SRCGVEFSEPALAAKRAREESGMVPLIIPVSVPVRTVGPTEVAQVGGADEDGTGLEQYPTEHKPSVIVT
R
RRSTRVPGTDAAAQ
AEDLNVKLEGEPSMRKPKQRPRPEPLIIPTKAGTFIAPPVYSNITPYQSHLRSPV
R
LADHPSERSFEPPPYTPPPILSPVREGSGLYFNAIISTSNIPAPPPITPKSAHRTLLRS
NSSEVTPPVL
S
VMGEATPVSIE
PRINVGTRFQAEIPMMRDRALAAFDPHKADLVWQPWEHLESSWEKQRQVDDLLTAACS
S
IFPGAGTNQELALHYLHESRGDIL
EALNKLLLRKPLRPHNHPLATYHYTGSDQWKTAERKLFNKGIAIY
K
KDFFLVQKL
IQTKTVAQCVEFYYTYKKQVKIGRNGTLTFGDLDIGDEKSGQEEVEVDVKTSQKFPRVPP
P
RRESPSEERLEPKREVTEPRKEGEEEVPDTQEKGEQEEGRERCRRAAAVKATQTLQANEA
ANDVLILRS
H
EPNAPGSAGIQTSEKPREGPGKSRRALPFTEKKKKAEAFNKTQNQENTFPCKKCG
RVFYKVKSRSAHMK
S
HAEQEKKAAALRLKEKEAAAAAAHQQALREESGEGEKG




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser