NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS48960.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
48960.1 Public Mus musculus 11 Cd79b 23 108 98 CCDS HistoryNCBI Gene:15985Re-query CCDS DB by CCDS ID:48960.1Re-query CCDS DB by GeneID:15985See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 48960.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000167143.1 ENSMUSP00000129029.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000167143.1Link to Ensembl Protein Viewer:ENSMUSP00000129029.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000167143Re-query CCDS DB by Protein ID:ENSMUSP00000129029
Original member Current member NCBI NM_008339.3 NP_032365.1 Accepted alive Link to Nucleotide Sequence:NM_008339.3Link to Protein Sequence:NP_032365.1Re-query CCDS DB by Nucleotide ID:NM_008339Re-query CCDS DB by Protein ID:NP_032365Link to BLAST:NP_032365.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032365.1 228 P15530 228 100% 0 0

Chromosomal Locations for CCDS 48960.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 106311807 106311905 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 106312007 106312048 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 106312322 106312440 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 106312633 106312941 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 106313661 106313711 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 106314418 106314484 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (687 nt):
ATGGCCACACTGGTGCTGTCTTCCATGCCCTGCCACTGGCTGTTGTTCCTGCTGCTGCTCTTCTCAGGTG
AG
CCGGTACCAGCAATGACAAGCAGTGACCTGCCACTGAATTTCCAAGGAAGCCCTTGTTCCCAGATCTG
G
CAGCACCCGAGGTTTGCAGCCAAAAAGCGGAGCTCCATGGTGAAGTTTCACTGCTACACAAACCACTCA
GGT
GCACTGACCTGGTTCCGAAAGCGAGGGAGCCAGCAGCCCCAGGAACTGGTCTCAGAAGAGGGACGCA
TT
GTGCAGACCCAGAATGGCTCTGTCTACACCCTCACTATCCAAAACATCCAGTACGAGGATAATGGTAT
C
TACTTCTGCAAGCAGAAATGTGACAGCGCCAACCATAATGTCACCGACAGCTGTGGCACGGAACTTCTA
GTC
TTAGGATTCAGCACGTTGGACCAACTGAAGCGGCGGAACACACTGAAAGATGGCATTATCTTGATCC
AG
ACCCTCCTCATCATCCTCTTCATCATTGTGCCCATCTTCCTGCTACTTGACAAGGATGACGGCAAGGC
T
GGGATGGAGGAAGATCACACCTATGAGGGCTTGAACATTGACCAGACAGCCACCTATGAAGACATAGTG
ACT
CTTCGGACAGGGGAGGTAAAGTGGTCGGTAGGAGAGCATCCAGGCCAGGAATGA


Translation (228 aa):
MATLVLSSMPCHWLLFLLLLFSGEPVPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHS
G
ALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELL
V
L
GFSTLDQLKRRNTLKDGIILIQTLLIILFIIVPIFLLLDKDDGKAGMEEDHTYEGLNIDQTATYEDIV
T
LRTGEVKWSVGEHPGQE




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser