NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS48930.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
48930.1 Public Mus musculus 11 Nt5c3b 23 108 98 CCDS HistoryNCBI Gene:68106Re-query CCDS DB by CCDS ID:48930.1Re-query CCDS DB by GeneID:68106See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 48930.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000107398.7 ENSMUSP00000103021.1 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000107398.7Link to Ensembl Protein Viewer:ENSMUSP00000103021.1Re-query CCDS DB by Nucleotide ID:ENSMUST00000107398Re-query CCDS DB by Protein ID:ENSMUSP00000103021
Original member Current member EBI,WTSI ENSMUST00000107399.8 ENSMUSP00000103022.2 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000107399.8Link to Ensembl Protein Viewer:ENSMUSP00000103022.2Re-query CCDS DB by Nucleotide ID:ENSMUST00000107399Re-query CCDS DB by Protein ID:ENSMUSP00000103022
Original member Current member NCBI NM_026561.5 NP_080837.3 Accepted alive Link to Nucleotide Sequence:NM_026561.5Link to Protein Sequence:NP_080837.3Re-query CCDS DB by Nucleotide ID:NM_026561Re-query CCDS DB by Protein ID:NP_080837Link to BLAST:NP_080837.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_080837.3 261 Q3UFY7-2 261 100% 0 0

Chromosomal Locations for CCDS 48930.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 100422928 100422945 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 100431077 100431277 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 100432918 100433080 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 100434695 100434784 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 100436155 100436240 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 100440040 100440086 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 100440185 100440254 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 100440829 100440927 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 100441044 100441055 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (786 nt):
ATGGCGGAGGAGGTAAGCAGCCTGATGAAGGCCACGGTCCTGATGCGGCAGCCCGGACGGGTGCAGGAAA
TT
GTGGGCGCCCTTCGCAGGGGCGGAGGAGACCGCCTGCAGGTGATTTCCGATTTTGACATGACCCTGAG
C
AGATTTGCTTACAATGGACAGCGATGCCCTTCTTCCCACAATATTCTGGATAACAGCAAAATTATCAGT
GAG
GATTGTCGCAAAGAGCTCACCGAGCTCTTTCACCACTATTATCCCATTGAGATCGACCCACACCGGA
CC
ATCAAAGAGAAGCTGCCTCACATGGTGCAGTGGTGGAGCAAAGCCCACAGTCTCCTGTGCCAGCAGAG
G
ATCCAGAAAGTCCAGATCGCTCAGGTGGTTGGAGAGTCCACTGCGATGCTCAGGGAGGGCTATAAGACG
TTC
TTCGACACACTCTACCAGAACAACATCCCCCTTTTCATCTTCTCAGCGGGCATTGGTGACATCCTGG
AA
GAAATTATCCGACAGATGAAAGTGTTCCACCCCAACATCCACATTGTGTCCAACTACATGGACTTCAG
T
GAGGATGGATTCCTGAAAGGATTCAAGGGGCAGCTCATTCACACCTACAACAAGAACAGCTCCGTGTGT
GAG
AACTCCAGCTACTTCCAGCAACTTCAGAACAAGACCAACATCATCCTGCTGGGAGACTCCATCGGGG
AC
CTCACCATGGCTGATGGGGTCCCCGGGGTGCAGAACATTCTCAAGATCGGCTTCCTGAATGACAAGCT
C
CCCGAGGCTCAGTGA


Translation (261 aa):
MAEEVSSLMKATVLMRQPGRVQEIVGALRRGGGDRLQVISDFDMTLSRFAYNGQRCPSSHNILDNSKIIS
E
DCRKE
LTELFHHYYPIEIDPHRTIKEKLPHMVQWWSKAHSLLCQQRIQKVQIAQVVGESTAMLREGYKT
F
FDTLYQNNIPLFIFSAGIGDILEEIIRQMKVFHPNIHIVSNYMDFSED
GFLKGFKGQLIHTYNKNSSVC
E
NSSYFQQLQNKTNIILLGDSIGDLTMADGVPGVQNILKIGFLNDK
LPEAQ



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser