NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS48764.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
48764.1 Public Mus musculus 11 4930505A04Rik 23 108 98 CCDS HistoryNCBI Gene:75087Re-query CCDS DB by CCDS ID:48764.1Re-query CCDS DB by GeneID:75087See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 48764.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000041763.13 ENSMUSP00000045288.7 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000041763.13Link to Ensembl Protein Viewer:ENSMUSP00000045288.7Re-query CCDS DB by Nucleotide ID:ENSMUST00000041763Re-query CCDS DB by Protein ID:ENSMUSP00000045288
Original member Current member NCBI NM_001100394.1 NP_001093864.1 Accepted alive Link to Nucleotide Sequence:NM_001100394.1Link to Protein Sequence:NP_001093864.1Re-query CCDS DB by Nucleotide ID:NM_001100394Re-query CCDS DB by Protein ID:NP_001093864Link to BLAST:NP_001093864.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001093864.1 233 Q5SPV6-1 233 100% 0 0

Chromosomal Locations for CCDS 48764.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '-' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 30426164 30426364 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 30427054 30427169 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 30446227 30446380 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 30454671 30454878 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 30471742 30471764 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (702 nt):
ATGGAGGGAGAGGAGAAGCAGCAACAGCATAAAACAGAAGATGATGGTATAGCGTGTGTAGCTGAAAGAA
AA
GTAGAAATCAAAAATGAAAAAAGTCCTGGGAAAAGCACACAACACCCAAAACCATGTGTGGACAGAAG
A
CGTGTAAATTATGCTAAATTCATACACACAAATGCAAGAACATACAACGAGCCAGTTCCCTACATTGAT
AAT
AAAGGGCCAGAAAAGCAGAGAAAATGGTGGTTCCATAATGAAGCACCAAAACATGTCTCCCAACCAT
CT
TATGACACCAAAAGTGTCCAGCGGAGTGACTTCCAGAAGCCAGCATGCCCATTGGTTTTGCCAGTCAA
A
CACAGCCGGATGCAAAAGCCTTCTTGTGGAATAGTTCCACTTACCAGTCTGGATGTATCAGGAGAACAT
GAG
AACAATTTTGTAGAATACATCTCTTTTATACATCAATATGATGCCAGGAGAACTCCCAATGAACCCA
TC
AAAGGAAAGAAACATGGAACCTTCGTGCAGAGAGAGATAAAACTAGGGGCTATGCCAATAGTTCCTAA
G
GCACCGGAGGTATTATTGAACACTCTAGAGTCAGGTTCATCAGAACAGCCCCAAAAAACAGACAAAGGA
AAT
TCATCAGGAGACAAAGTGACCTCACCAGGCCTATGCCAACAGAATTCCCAAGAGTTGCTGGAGACTT
AG


Translation (233 aa):
MEGEEKQQQHKTEDDGIACVAERKVEIKNEKSPGKSTQHPKPCVDRRRVNYAKFIHTNARTYNEPVPYID
N
KGPEKQ
RKWWFHNEAPKHVSQPSYDTKSVQRSDFQKPACPLVLPVKHSRMQKPSCGIVPLTSLDVSGEH
E
NNFVEYISFIHQYDARRTPNEPIKGK
KHGTFVQREIKLGAMPIVPKAPEVLLNTLESGSSEQPQKTDKG
N
SSGDKVTSPGLCQQNSQELLET




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser