NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS4870.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
4870.1 Public Homo sapiens 6 UBR2 22 109 92 CCDS HistoryNCBI Gene:23304Re-query CCDS DB by CCDS ID:4870.1Re-query CCDS DB by GeneID:23304See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 4870.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000372899.5 ENSP00000361990.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000372899.5Link to Ensembl Protein Viewer:ENSP00000361990.1Re-query CCDS DB by Nucleotide ID:ENST00000372899Re-query CCDS DB by Protein ID:ENSP00000361990
Original member Current member NCBI NM_015255.2 NP_056070.1 Accepted alive Link to Nucleotide Sequence:NM_015255.2Link to Protein Sequence:NP_056070.1Re-query CCDS DB by Nucleotide ID:NM_015255Re-query CCDS DB by Protein ID:NP_056070Link to BLAST:NP_056070.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_056070.1 1755 Q8IWV8-1 1755 100% 0 0

Chromosomal Locations for CCDS 4870.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 6 (NC_000006.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 42564320 42564397 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42573734 42573993 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42592151 42592229 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42594191 42594304 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42603588 42603718 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42605721 42605859 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42606589 42606651 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42612171 42612291 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42615071 42615178 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42616002 42616090 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42617240 42617338 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42632552 42632715 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42632805 42632904 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42635418 42635546 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42637011 42637194 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42640209 42640270 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42641582 42641692 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42642416 42642481 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42644214 42644336 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42644473 42644536 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42645466 42645590 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42648118 42648170 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42650284 42650386 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42652023 42652071 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42652491 42652645 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42655621 42655723 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42658024 42658133 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42658240 42658320 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42658646 42658824 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42659656 42659855 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42662184 42662277 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42663258 42663419 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42665409 42665512 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42666167 42666245 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42670092 42670240 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42670660 42670715 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42673791 42673887 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42674126 42674193 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42676056 42676191 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42676783 42676873 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42678539 42678669 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42679724 42679832 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42683055 42683111 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42684794 42684871 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42688216 42688386 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42689569 42689670 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 42691032 42691173 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (5268 nt):
ATGGCGTCGGAGCTAGAGCCAGAGGTGCAGGCCATCGACCGGAGCTTGCTGGAATGTTCGGCCGAGGAGA
TT
GCGGGGAAATGGCTGCAAGCAACTGACCTCACTAGAGAAGTGTACCAGCATTTAGCCCACTATGTACC
C
AAAATCTACTGCAGGGGTCCCAACCCTTTTCCACAGAAAGAAGACATGCTGGCACAGCATGTTTTGTTG
GGA
CCAATGGAATGGTACCTTTGTGGTGAAGATCCTGCATTTGGATTTCCAAAACTTGAGCAAGCAAACA
AA
CCTTCTCATCTTTGTGGTCGTGTTTTTAAAGTAGGAGAGCCTACATATTCTTGCAGAGACTGTGCAGT
T
GATCCAACTTGTGTTTTGTGCATGGAGTGCTTTTTGGGAAGTATTCACAGAGATCATCGATATAGGATG
ACA
ACATCAGGAGGTGGAGGTTTCTGTGACTGTGGTGATACTGAAGCCTGGAAAGAGGGTCCTTACTGTC
AA
AAACATGAACTTAACACCTCTGAAATTGAGGAAGAAGAGGATCCTCTTGTTCATTTATCAGAAGATGT
G
ATAGCAAGAACTTATAACATTTTTGCTATTACGTTTCGGTATGCAGTAGAAATATTAACCTGGGAAAAA
GAA
AGTGAATTGCCAGCAGATTTAGAGATGGTAGAGAAGAGTGACACCTACTATTGCATGCTGTTTAATG
AT
GAGGTTCACACCTATGAACAAGTTATTTATACTCTTCAGAAAGCTGTTAACTGTACACAAAAAGAAGC
T
ATTGGTTTTGCAACTACAGTAGATCGAGATGGGCGTAGGTCTGTTCGATATGGAGATTTTCAGTATTGT
GAG
CAAGCAAAATCAGTAATTGTGAGAAATACCAGTAGACAGACAAAGCCACTCAAAGTTCAAGTTATGC
AT
TCGTCTATTGTCGCACATCAGAATTTTGGTTTGAAACTTTTGTCTTGGCTGGGAAGTATTATTGGATA
T
TCAGATGGCCTTCGCCGGATTTTATGTCAAGTTGGTTTACAAGAAGGGCCAGATGGTGAAAACTCTTCT
CTA
GTGGACAGACTGATGCTTAGTGATTCCAAATTATGGAAAGGTGCTAGGAGTGTATATCATCAGTTGT
TC
ATGAGCAGTCTGCTTATGGATTTGAAATACAAGAAACTATTTGCTGTTCGATTTGCAAAAAATTACCA
G
CAGTTGCAGAGAGATTTTATGGAGGATGATCACGAGCGAGCAGTGTCGGTGACTGCTCTATCTGTCCAG
TTC
TTCACCGCACCTACTCTGGCTCGAATGCTCATCACAGAAGAAAACTTAATGAGCATTATCATTAAGA
CT
TTTATGGATCATTTGAGACATCGAGATGCCCAGGGCAGATTTCAGTTTGAACGATACACTGCTTTACA
A
GCCTTCAAATTTAGGAGAGTACAGAGCCTTATTTTAGATCTCAAGTATGTGTTAATTAGCAAACCAACT
GAA
TGGTCAGATGAGCTGAGGCAGAAGTTCCTAGAAGGGTTTGATGCCTTTTTGGAATTACTAAAATGTA
TG
CAGGGAATGGATCCAATTACACGTCAAGTAGGACAACATATTGAAATGGAACCAGAGTGGGAAGCAGC
C
TTCACACTACAAATGAAATTAACACATGTCATTTCAATGATGCAGGACTGGTGTGCTTCAGATGAAAAA
GTG
TTAATCGAAGCTTACAAGAAATGTCTCGCTGTACTGATGCAGTGTCATGGTGGTTATACTGATGGTG
AA
CAGCCAATCACACTAAGCATTTGTGGACATTCAGTGGAAACTATCAGATACTGTGTTTCCCAAGAAAA
A
GTTAGCATTCACCTCCCAGTTTCTCGCTTACTTGCAGGTTTACATGTATTATTAAGCAAAAGTGAAGTG
GCA
TATAAATTTCCAGAGCTCCTACCTCTAAGTGAACTTAGCCCACCCATGTTGATAGAACACCCTCTTA
GA
TGTCTTGTTCTGTGTGCCCAAGTACATGCCGGAATGTGGAGAAGAAATGGGTTCTCTCTAGTAAACCA
G
ATTTATTACTACCATAATGTGAAATGCAGACGTGAGATGTTTGACAAGGATGTAGTAATGCTTCAGACA
GGT
GTCTCCATGATGGATCCAAATCATTTCCTGATGATCATGCTCAGCCGCTTTGAACTTTATCAGATTT
TC
AGTACTCCAGACTATGGAAAAAGATTTAGTTCTGAGATTACCCATAAGGATGTTGTTCAGCAGAACAA
T
ACTCTAATAGAAGAAATGCTATACCTCATTATAATGCTTGTTGGAGAGAGATTTAGTCCTGGAGTTGGA
CAG
GTAAATGCTACAGATGAAATCAAGCGAGAGATTATCCATCAGTTGAGTATCAAGCCTATGGCTCATA
GT
GAATTGGTAAAGTCTTTACCTGAAGATGAGAACAAGGAGACTGGCATGGAGAGTGTAATCGAAGCAGT
T
GCCCATTTCAAGAAACCTGGATTAACAGGACGAGGCATGTATGAACTGAAACCAGAATGTGCCAAAGAG
TTC
AACTTGTATTTCTATCACTTTTCAAGGGCAGAACAGTCCAAGGCAGAAGAAGCGCAACGGAAATTGA
AA
AGACAAAATAGAGAAGATACAGCACTCCCACCTCCGGTGTTGCCTCCATTCTGCCCTCTGTTTGCAAG
C
CTGGTTAACATTTTGCAGTCAGATGTCATGTTGTGCATCATGGGAACAATTCTGCAATGGGCTGTGGAA
CAT
AATGGATATGCCTGGTCAGAGTCCATGCTGCAAAGGGTGTTACATTTAATTGGCATGGCACTACAAG
AA
GAAAAACAACATTTAGAGAATGTCACGGAAGAGCATGTAGTAACATTTACCTTCACTCAGAAGATATC
A
AAACCTGGTGAAGCGCCAAAAAATTCTCCTAGCATACTAGCTATGCTGGAAACACTACAAAATGCTCCC
TAC
CTAGAAGTCCACAAAGACATGATTCGGTGGATATTGAAGACTTTTAATGCTGTTAAAAAGATGAGGG
AG
AGTTCACCTACCAGTCCCGTGGCAGAGACAGAAGGAACCATAATGGAAGAGAGTTCAAGGGACAAAGA
C
AAAGCTGAGAGGAAGAGAAAAGCAGAGATTGCCAGACTGCGCAGAGAAAAGATCATGGCTCAGATGTCT
GAA
ATGCAGCGGCATTTTATTGATGAAAACAAAGAACTCTTTCAGCAGACATTAGAACTGGATGCCTCAA
CC
TCTGCTGTTCTTGATCATAGCCCTGTGGCTTCAGATATGACACTTACAGCACTGGGCCCCGCACAAAC
T
CAGGTTCCTGAACAAAGACAATTCGTTACATGTATATTGTGTCAAGAGGAGCAAGAAGTTAAAGTGGAA
AGC
AGGGCAATGGTCTTGGCAGCATTTGTTCAGAGATCAACTGTATTATCAAAAAACAGAAGTAAATTTA
TT
CAAGATCCAGAAAAATATGATCCATTATTCATGCACCCTGATCTGTCTTGTGGAACACACACTAGTAG
C
TGTGGGCACATTATGCATGCCCATTGTTGGCAAAGGTATTTTGATTCCGTTCAAGCTAAAGAACAGCGA
AGG
CAACAGAGATTACGCTTACATACGAGCTATGATGTAGAAAACGGAGAATTCCTTTGCCCCCTTTGTG
AA
TGCTTGAGTAATACTGTTATTCCTCTGCTGCTTCCTCCAAGAAATATTTTTAACAACAGGTTAAATTT
T
TCAGACCAACCAAATCTGACTCAGTGGATTAGAACAATATCTCAGCAAATAAAAGCATTACAGTTTCTT
AGG
AAAGAAGAAAGTACTCCTAATAATGCCTCTACAAAGAATTCAGAAAATGTGGATGAATTACAGCTCC
CT
GAAGGGTTCAGGCCTGATTTTCGTCCTAAGATCCCTTATTCTGAGAGCATAAAAGAAATGCTAACGAC
A
TTTGGAACTGCTACCTACAAGGTGGGACTAAAGGTTCATCCCAATGAAGAGGATCCTCGTGTTCCCATA
ATG
TGTTGGGGTAGCTGCGCGTACACCATCCAAAGCATAGAAAGAATTTTGAGTGATGAAGATAAACCAT
TG
TTTGGTCCTTTACCTTGCAGACTGGATGACTGTCTTAGGTCATTGACGAGATTTGCCGCAGCACACTG
G
ACAGTGGCATCAGTTTCAGTGGTGCAAGGACATTTTTGTAAACTTTTTGCATCACTGGTGCCTAATGAC
AGC
CATGAGGAACTTCCATGCATATTAGATATTGACATGTTTCATTTATTGGTGGGCTTGGTGCTTGCAT
TT
CCTGCGTTGCAGTGTCAGGATTTTTCAGGGATCAGCCTTGGCACTGGAGACCTTCACATTTTCCATCT
G
GTTACTATGGCACACATCATACAGATCTTACTTACCTCATGTACAGAAGAGAATGGCATGGATCAAGAA
AAT
CCCCCTTGTGAAGAAGAATCAGCAGTTCTTGCTTTGTATAAAACACTTCACCAGTATACGGGAAGTG
CC
TTGAAAGAAATACCATCCGGCTGGCATCTGTGGAGGAGTGTCAGAGCTGGAATCATGCCTTTCCTGAA
G
TGTTCTGCTTTATTTTTTCATTACTTAAATGGAGTTCCTTCCCCACCCGACATTCAAGTTCCTGGAACA
AGC
CATTTTGAACATTTATGTAGCTATCTTTCCCTACCAAACAACCTCATTTGCCTTTTTCAAGAAAATA
GT
GAGATAATGAATTCACTGATTGAAAGTTGGTGCCGTAACAGTGAAGTTAAAAGATATCTAGAAGGTGA
A
AGAGATGCTATAAGATATCCAAGAGAATCTAACAAATTAATAAACCTTCCAGAGGATTACAGCAGCCTC
ATT
AATCAAGCATCCAATTTCTCGTGCCCGAAATCAGGTGGTGATAAGAGCAGAGCCCCAACTCTGTGCC
TT
GTGTGCGGATCTCTGCTGTGCTCCCAGAGTTACTGCTGCCAGACTGAACTGGAAGGGGAGGATGTAGG
A
GCCTGCACAGCTCACACCTACTCCTGTGGCTCTGGAGTGGGCATCTTCCTGAGAGTACGGGAATGTCAG
GTG
CTATTTTTAGCTGGCAAAACCAAAGGCTGTTTTTATTCTCCTCCTTACCTTGATGACTATGGGGAGA
CC
GACCAGGGACTCAGACGGGGAAATCCTTTACATTTATGCAAAGAGCGATTCAAGAAGATTCAGAAGCT
C
TGGCACCAACACAGTGTCACAGAGGAAATTGGACATGCACAGGAAGCCAATCAGACACTGGTTGGCATT
GAC
TGGCAACATTTATAA


Translation (1755 aa):
MASELEPEVQAIDRSLLECSAEEIAGKWLQATDLTREVYQHLAHYVPKIYCRGPNPFPQKEDMLAQHVLL
G
PMEWYLCGEDPAFGFPKLEQANKPSHLCGRVFKVGEPTYSC
RDCAVDPTCVLCMECFLGSIHRDHRYRM
T
TSGGGGFCDCGDTEAWKEGPYCQKHELNTSEIEEEE
DPLVHLSEDVIARTYNIFAITFRYAVEILTWEK
E
SELPADLEM
VEKSDTYYCMLFNDEVHTYEQVIYTLQKAVNCTQKEAIGFATTVDRDGRRSVRYGDFQYC
E
QAKSVIV
RNTSRQTKPLKVQVMHSSIVAHQNFGLKLLSWLGSIIGYSDGLRRILCQVGLQEGPDGENSS
L
VDRLMLSDSKLWK
GARSVYHQLFMSSLLMDLKYKKLFAVRFAKNYQQLQRDFMEDDHERAVSVTALSVQ
F
FTAPTL
ARMLITEENLMSIIIKTFMDHLRHRDAQGRFQFERYTALQAFKFRRVQSLILDLKYVLISKPT
E
WSDELRQKFLEGFDAFLELLKCMQ
GMDPITRQVGQHIEMEPEWEAAFTLQMKLTHVISMMQDWCASDEK
V
LIEAYKKCLAVLMQCHGGYTDGEQPITLSICGHSVETIRYCVSQEKVSIHLPVSRLLA
GLHVLLSKSEV
A
YKFPELLPL
SELSPPMLIEHPLRCLVLCAQVHAGMWRRNGFSLVNQIYYYHNVKCRREMFDKDVVMLQT
G
VSMMDPNHFLMIMLSRFELYQIFSTPDYGKRFSSEITHK
DVVQQNNTLIEEMLYLIIMLVGERFSPGVG
Q
VNATDEIKREIIHQLSIKPMAHSELVKSLPED
ENKETGMESVIEAVAHFKKPGLTGRGMYELKPECAKE
F
NLYFYHFSRAEQSK
AEEAQRKLKRQNREDTALPPPVLPPFCPLFASLVNILQSDVMLCIMGTILQWAVE
H
NGYAWSESMLQR
VLHLIGMALQEEKQHLENVTEEHVVTFTFTQKISKPGEAPKNSPSILAMLETLQNAP
Y
LEVHKDMIRWILK
TFNAVKKMRESSPTSPVAETEGTIMEESSRDKDKAERKRKAEIARLRREKIMAQMS
E
MQRHFIDENKELFQQTLELDASTSAVLDH
SPVASDMTLTALGPAQTQVPEQRQFVTCILCQEEQEVKVE
S
RAMVLAAFVQRSTVLSKNRSKFIQDP
EKYDPLFMHPDLSCGTHTSSCGHIMHAHCWQRYFDSVQAKEQR
R
QQRLRLHTSYDVENGEFLCPLCECLSNTVIPLLLPPRNIFN
NRLNFSDQPNLTQWIRTISQQIKALQFL
R
KEESTP
NNASTKNSENVDELQLPEGFRPDFRPKIPYSESIKEMLTTFGTATYKVGLKVHPNEEDPRVPI
M
CWGSCAYTIQSI
ERILSDEDKPLFGPLPCRLDDCLRSLTRFAAAHWTVASVSVVQGHFCKLFASLVPND
S
HEELPCILDIDMFHLL
VGLVLAFPALQCQDFSGISLGTGDLHIFHLVTMAHIIQILLTSCTEENGMDQE
N
PPCEEESAVLALYKTLHQYTG
SALKEIPSGWHLWRSVRAGIMPFLKCSALFFHYLNGVPSPPDIQVPGT
S
HFEHLCSYLSLPNNLICLFQENSEIMNSLIE
SWCRNSEVKRYLEGERDAIRYPRESNKLINLPEDYSSL
I
NQASNF
SCPKSGGDKSRAPTLCLVCGSLLCSQSYCCQTELEGEDVGACTAHTYSCGSGVGIFLRVRECQ
V
LFLAGKTKGCFYSPPYLDDYGETDQGL
RRGNPLHLCKERFKKIQKLWHQHSVTEEIGHAQEANQTLVGI
D
WQHL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser