NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS48685.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
48685.1 Public Mus musculus 10 Cep290 21 106 86 CCDS HistoryNCBI Gene:216274Re-query CCDS DB by CCDS ID:48685.1Re-query CCDS DB by GeneID:216274See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Provisional (this record has not been manually reviewed by the collaboration)


Attributes
Inferred exon combination

Sequence IDs included in CCDS 48685.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000164751 ENSMUSP00000130899 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000164751Link to Ensembl Protein Viewer:ENSMUSP00000130899Re-query CCDS DB by Nucleotide ID:ENSMUST00000164751Re-query CCDS DB by Protein ID:ENSMUSP00000130899
Original member NCBI NM_146009.2 NP_666121.2 Updated not alive Link to Nucleotide Sequence:NM_146009.2Link to Protein Sequence:NP_666121.2Re-query CCDS DB by Nucleotide ID:NM_146009Re-query CCDS DB by Protein ID:NP_666121
Current member NCBI NM_146009.3 NP_666121.2 Accepted alive Link to Nucleotide Sequence:NM_146009.3Link to Protein Sequence:NP_666121.2Re-query CCDS DB by Nucleotide ID:NM_146009Re-query CCDS DB by Protein ID:NP_666121Link to BLAST:NP_666121.2

Chromosomal Locations for CCDS 48685.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 10 (NC_000076.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 100488307 100488408 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100488562 100488639 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100489320 100489389 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100490147 100490193 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100492648 100492791 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100494901 100494954 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100495641 100495661 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100495823 100495975 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100496689 100496871 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100497940 100498029 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100499062 100499184 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100500147 100500270 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100501103 100501275 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100508664 100508826 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100510487 100510587 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100510662 100510749 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100512287 100512399 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100513920 100514004 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100514458 100514600 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100515134 100515298 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100516154 100516303 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100517777 100517892 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100518454 100518556 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100518645 100518875 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100523230 100523403 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100528549 100528660 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100530018 100530223 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100531101 100531252 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100536806 100536917 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100537436 100537891 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100538926 100539090 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100539984 100540091 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100540336 100540470 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100541550 100541816 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100542417 100542524 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100543242 100543441 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100544917 100545130 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100546375 100546512 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100548728 100548949 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100549253 100549375 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100551364 100551509 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100551817 100551972 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100554411 100554534 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100558071 100558205 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100559605 100559691 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100561240 100561404 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100562109 100562231 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100563266 100563438 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100567011 100567152 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100568081 100568154 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100568815 100568909 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100572063 100572142 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 100572880 100573107 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (7440 nt):
ATGCCACCTAATATAAAGTGGAAAGAATTAATCAAAGTTGATCCAGATGACCTGCCACGGCAAGAAGAGT
TA
GCAGATAAATTATTGATATCTTTATCCAAGGTGGAAGTAAATGAACTAAAAAATGAAGACCAAGAAAA
C
ATGATACATCTATTCAGAATTACCCAGTCTCTAATGAAGATGAAAGCCCAGGAAGTAGAGCTCGCTTTG
GAA
GAAGTTGAAAAGGCTGGAGAAGAACAAGCAAAATTTGAAAATCAATTAAAGACAAAAGTAATGAAAC
TG
GAAAATGAACTGGAGATGGCTCAGCAGTCTGCAGGGGGACGTGACACTCGGTTTTTACGTGACGAAAT
T
CGCCAACTTGAGAAGCAGCTGGAACAAAAAGATAGAGAATTAGAGGATATGGAAAAAGAATTGGATAAA
GAA
AAGAAGGTTAATGAACAATTGGCTCTTCGAAATGAGGAGGCAGAAAATGAAAACAGCAAATTAAGAA
GA
GAGAACAAACGTCTAAAGAAAAAGAATGAGCAGCTTCGGCAGGACATTATTGACTACCAGAAACAAAT
A
GATTCACAGAAAGAATCACTTCTGTCAAGGAGAGGAGAAGACAGTGACTACCGATCACAGTTGTCTAAA
AAG
AACTATGAACTTGTTCAATATCTGGACGAAATACAGACCTTAACAGAAGCTAATGAGAAGATTGAAG
TT
CAGAACCAAGAAATGAGGAAAAACCTGGAAGAGTCTGTGCAGGAGATGGAGAAGATGACTGATGAGTA
C
AACAGGATGAAAGCGCTTGTGCATCAGTCGGATGCTGTCATGGACCAGATCAAGAAGGAGAATGAGCAC
TAT
CGCCTGCAAGTTCGAGAGCTCACGGATCTTCTGAAGGCGAAGGATGAAGAGGACGATCCAGTCATGA
TG
GCTGTTAACGCAAAAGTGGAAGAGTGGAAGTTAATTTTGTCTTCTAAAGATGATGAAATCATTGAATA
T
CAGCAAATGCTACAGAGTCTGAGAGGGAAACTTAAAAATGCCCAACTTGATGCAGACAAAAGTAACATC
ATG
GCTCTGAAACAGGGTATCCAGGAGCGAGACAGTCAAATTAAGATGCTTACTGAGCAAGTAGAACAGT
AT
ACGAAAGAAATGGAAAAAAATACGTTTATTATTGAAGATTTGAAAAATGAACTCCAAAAAGACAAAGG
T
ACTTCAAACTTTTATCAGCAGACTCATTATATGAAAATTCACTCAAAAGTACAAATTTTAGAAGAGAAA
ACA
AAAGAGGCCGAGAGAATAGCTGAGCTGGCTGAGGCTGATGCCAGGGAGAAGGACAAAGAATTGGTTG
AG
GCTCTGAAGAGATTAAAAGATTATGAATCTGGAGTATATGGCTTAGAAGATGCTGTTATCGAAATAAA
G
AATTGTAAAGCCCAAATTAAAATAAGAGATGGAGAGATGGAAGTGTTGACCAAGGAGATCAATAAGCTT
GAG
ATGAAGATCAATGACATCCTTGATGAAAACGAAGCCCTTAGAGAGCGGGCTGGCCTTGAACCCAAGA
CA
ATGATTGATTTGACTGAATTTAGAAACAGCAAACGGTTAAAGCAGCAACAGTACAGAGCTGAGAACCA
G
GTTCTTTTGAAAGAGATCGAAAGTCTAGAGGAGGAGCGTCTTGACTTGAAAAGAAAGATTCGTCAAATG
GCT
CAAGAAAGAGGCAAAAGGAACGCAGCCTCAGGATTAACCATTGACGACTTGAACTTATCTGAAACCT
TT
TCTCATGAAAATAAAATAGAAGGAAGAAAACTAAATTTTATGAGCCTCAATAATATGAATGAAACACA
A
TCAAAGAATGAGTTTCTTTCAAGAGAATTGGCTGAAAAGGAAAAAGATTTAGAAAGAAGTAGGACAGTA
ATT
GCTAAATTCCAGAGTAAACTAAAAGAATTAGTCGAAGAAAATAAGCAACTTGAAGAAGGTATGAAAG
AA
ATTTTGCAAGCTATTAAGGACATGCCGAAGGATTCTGATGTGAAAGGAGGTGAAACATCTTTAATCAT
C
CCGAGTCTTGAAAGACTGGTTAACGCTATGGAATCAAAGAATGCAGAAGGAATCTTCGATGCCAGCTTG
CAT
CTAAAAGCCCAAGTTGACCAACTTACAGGAAGGAATGAAGAATTAAGGCAAGAACTCAGGCAATCTC
GG
AAAGAGGCTGTAAATTATTCACAGCAGTTGGTAAAAGCAAACTTAAAGATTGACCACCTTGAGAAGGA
A
ACTGACCTTCTACGTCAGTCTGCAGGCTCCAATGTAGTATACAAAGGCATAGACTTACCCGATGGGATA
GCA
CCATCCAGTGCCTATATCATCAATTCTCAGAATGAATACTTAATACATCTTTTGCAGGAACTAGACA
AT
AAAGAAAAGAAATTAAAACATTTAGAAGATTCCCTTGAAGATTATAACAGAAAGTTTGCAGTGATTCG
T
CATCAACAAAGTTTATTATATAAAGAATACCTAAGTGAAAAGGATATTTGGAAAACAGACTCTGAGATG
ATA
AGAGAGGAGAAGAGAAAACTGGAAGATCAAGCTGAGCAGGATGCTGTGAAAGTAAAAGAGTACAACA
AT
TTGCTCAGTGCTCTTCAGATGGATTCGAACGAGATGAAGAAAATGCTCTCAGAAAACAGTAGGAAAAT
C
ACCGTTCTGCAAGTGAACGAGAAGTCCCTCATCCGGCAGTACACCACCTTAGTGGAGATGGAGCGGCAC
CTG
AGAAAGGAAAACGGGAAACACAGGAATGACGTCATAGCCATGGAAGCCGAAGTCACTGAAAAACTTG
GA
AGTTTGCAAAGATTCAAGGAAATGGCCATCTTCAAGATTGCAGCTCTTCAGAAGGTTATAGATAATAG
T
GTTTCTTTGTCTGAATTAGAACTAGCCAATAAACAGTACAATGAGCTGACTACTAAGTACAGGGACATC
TTG
CAGAAAGATAATATGCTTGTTCAAAGAACAAGTAACTTAGAACACCTGGAGTGTGAGAATGCATCGC
TA
AAAGAACAGATGGAGGCTATCAGTAAAGAGCTGGAGATTACAAAGGAAAAACTCCATACCATTGAACA
G
GCCTGGGAACAAGAAACGAAGTTAGGAAATGACTCAAACATGGATAAGGCTAAGAAATCAATGACAAAC
AGT
GACATTGTTTCTATTTCAAAGAAAATCACTGTGTTGGAGATGAAGGAATTAAATGAAAGGCAGAGGG
CT
GAACACTGTCAGAAAATGTATGAGCACTTAAGGACTTCATTAAAGCAAATGGAAGAACGTAATTTTGA
A
TTGGAAACCAAGTTCACTGAGCTTACTAAAATCAACCTGGATGCACAAAAGGTGGAGCAGATGTTGAGA
GAC
GAATTAGCTGATAGTGTGACCAAGGCAGTAAGTGATGCTGACCGACAGCGGATTCTAGAACTAGAGA
AG
AGTGAAGTGGAGCTCAAAGTTGAAGTGTCCAAGCTGAGAGAGATTTCAGATATTGCCAAAAGACAAGT
T
GATTTTTTGAATTCGCAACAACAGTCCAGGGAAAAGGAAGTGGAATCCCTCAGAACGCAGCTGCTGGAC
TTC
CAGGCACAATCTGACGAAAAGGCTCTAATTGCCAAATTGCACCAACATGTTGTCTCTCTTCAAATTA
GT
GAGGCCACTGCCCTCGGTAAGTTAGAGTCAGTTACGTCCAAACTCCAGAAGATGGAAGCCTACAATTT
G
CGCTTAGAACAGAAACTGGATGAAAAAGAGCAGGCGCTCTACTATGCTCGTTTGGAAGGTAGAAACAGA
GCA
AAACACCTGCGCCAAACCATTCAGTCGCTTCGAAGACAGTTCAGTGGAGCTCTACCCTTAGCACAGC
AG
GAAAAGTTCTCCAAAACGATGATTCAGTTGCAAAATGACAAACTTAAGATAATGCAAGAAATGAAGAA
T
TCGCAACAGGAACACAGAAATATGGAAAACAAAACACTGGAGTTGGAATTAAAATTAAAAGGCTTAGAA
GAA
TTGATCAGTACTTTAAAGGATGCCAGGGGAGCCCAGAAGGTAATCAATTGGCATGTGAAAATAGAAG
AA
CTTCGCCTCCAAGAACTTAAGCTAAATAGAGAACTAGTCAAGGGTAAAGAAGAAATCAAATATTTGAA
T
AATATCATCTCTGAATATGAGCATACAATCAACAGTCTAGAGGAAGAAATTGTTCAGCAAAGCAAGTTC
CAT
GAAGAAAGACAGATGGCTTGGGATCAAAGAGAAGTTGAGCTGGAACGCCAGTTAGACATTTTTGATC
AT
CAGCAAAATGAAATACTCAGTGCAGCACAAAAGTTTGAAGACTCTACAGGATCAATGCCAGACCCCAG
C
TTGCCTCTTCCAAACCAACTTGAAATTGCTCTAAGAAAAATTAAGGAGAATATTCAAGTAATTCTTAAA
ACA
CAAGCAACTTGCAAGTCACTAGAAGAGAAACTAAAAGAAAAAGAATCTGCTTTACGGTTGGCAGAGC
AA
AATATTCTGTCAAGAGACAAAGTAATCAATGAACTGAGGCTTCGATTGCCTGCCACGGCTGATCGAGA
A
AAACTTATAGCTGAGCTAGAAAGAAAAGAGCTGGAGCCGAAATCTCATCACACAATGAAAATTGCCCAC
CAA
ACTATTGCCAACATGCAGGCAAGGTTAAATCACAAGGAAGAAGTATTGAAGAAATACCAGCACCTTC
TG
GAGAAGGCCAGAGAGGAGCAAAGAGAAATTGTTAAGAAGCATGAGGAAGACCTTCATGTTCTTCATCA
C
AAATTAGAACAACAGGCCGATAATTCACTCAATAAATTCAGACAGACAGCTCAGGATTTACTTAAGCAG
TCT
CCTGCTCCAGTTCCCACCAACAAACATTTCATTCGTCTGGCCGAGATGGAGCAGACAGTAGCAGAAC
AA
GATGACTCTCTGTCCTCACTTTTGACCAAACTAAAGAAAGTATCAAAAGATTTGGAAAAACAAAAAGA
A
ATCACTGAGTTAAAAGTCAGAGAGTTTGAAAATACCAAACTACGGCTCCAAGAAACTCATGCCAGTGAG
GTA
AAGAAAGTGAAAGCAGAGGTAGAGGACTTAAGGCATGCTCTAGCCCAAGCACACAAGGACTCCCAGA
GT
TTAAAGTCTGAACTCCAGGCTCAGAAAGAAGCAAACTCCAGAGCTCCAACAACCACAATGAGGAATCT
T
GTAGACAGGCTAAAGAGCCAACTAGCCTTGAAAGAGAAGCAACAAAAGGCACTTAGTCGAGCCCTGTTG
GAA
CTTCGGTCGGAAATGACAGCAGCAGCTGAGGAACGTATAATCGCTGTAACTTCTCAAAAAGAGGCAA
AT
CTCAATGTTCAACAAGTTGTTGAGCGCCATACTAGAGAGCTAAAGTCACAAATTGAAGATTTAAATGA
A
AATCTTTTAAAATTGAAAGAAGCTCTTAAAACAAGTAAGAACAAAGAAAATTCACTAGCTGATGATTTA
AAT
GAATTAAATAATGAACTGCAAAAAAAGCAAAAAGCTTATAATAAAATCCTTAGAGAGAAAGATGGAA
TT
GATCAAGAAAATGATGAACTGAGAAGACAGATTAAAAGACTGTCCAGTGGACTGCAGAGCAAAACTTT
G
ATAGATAACAAGCAAAGTTTAATCGATGAACTTCAAAAGAAAGTTAAAAAACTTGAAAGCCAACTGGAA
AGA
AAGGTGGATGACGTAGACATAAAGCCGGTGAAGGAAAAGAGTAGTAAAGAAGAATTAATTAGGTGGG
AA
GAAGGTAAGAAATGGCAAACCAAAGTAGAGGGACTACGAAACAGACTAAAGGAGAAGGAAGGAGAAGC
C
CACGGCCTGGCAAAGCAGCTGAATACCTTAAAGGAACTTTTTGCCAAAGCTGATAAAGAGAAACTTACT
TTG
CAGAAGAAACTGAAAACAACAGGAATGACTGTTGACCAGGTTTTAGGAGTGCGAGCTTTGGAATCTG
AA
AAAGAGTTGGAAGAGCTAAAAAAGAAAAATCTGGACCTAGAAAATGACATATTATACATGAGGACCCA
G
CAGGCTCTTCCACGAGATTCTGTTGTGGAAGACTTACATTTACAAAATAAATACCTTCAAGAAAAACTT
CAT
ACTTTAGAAAAAAAACTTTCAAAGGAGAAATATTCTCAGTCTTTGACTTCAGAAATAGAGTCAGATG
AT
CACTGTCAAAAAGAACAAGAACTTCAGAAGGAAAATTTGAAGTTGTCATCTGAAAACATCGAGCTGAA
A
TTTCAACTTGAACAAGCAAATAAAGATTTGCCAAGACTAAAGAATCAAGTGAAAGATTTGAAGGAAATG
TGT
GAATTTCTTAAGAAAGGAAAACTGGAACTTGAGCGGAAGCTTGGTCAGGTCAGAGGGGCTGGTAGAA
GT
GGGAAGACAATCCCAGAACTAGAAAAAACCATTGGGTTAATGAAGAAAGTAGTTGAAAAAGTCCAAAG
A
GAAAATGAACAATTGAAAAAGGCATCAGGAATACTGACTAGTGAAAAAATGGCTACTATTGAGGAAGAA
AAT
AGAAACTTAAAGGCTGAACTAGAAAAGCTTAAAGCTCACTTTGGACGTCAGTTGAGTATGCAGTTTG
AA
TCTAAGAACAAAGGTACTGAGAAAATTGTTGCCGAAAATGAACGGCTTCGGAAAGAACTTAAGAAAGA
A
ATAGAAGCCTCTGAGAAACTGCGGATAGCTAAGAACAACTTAGAGCTGGTGAACGACAAGATGGCAGCT
CAA
CTCGAAGAAACTGGGAAGAGACTACAGTTTGCAGAAAGTAGAGCCCCACAGCTGGAAGGTGCTGACA
GC
AAGAGCTGGAAGTCAATTGTGGTCTCAAGAGTGTATGAGACCAAGATGAAAGAGCTTGAAAGTGACAT
T
GCCAAAAAGAATCAAAGTATCACTGACCTTAAACAGCTTGTAAGAGAAGCAACAGAGAGAGAACAGAAA
GCT
AAGAAATACACTGAAGACCTTGAACAACAGATTGAGATCCTCAAAAATGTTCCTGAAGGTGCCGAGA
CA
GAGCAAGAGCTTATACGGGAACTCCAGCTTCTTAGATTAGCCAATAATCAGATGGATAAAGAAAGGGC
A
GAATTAATCCATCAGATAGAAATTAACAAGGACCAAACCAGAGCTGACAGTAGCATACCTGATTCTGAT
CAA
CTAAAGGAAAAGATAAATGACCTGGAGACACAACTCAGAAAGTTGGAGCTAGAAAAGCAACATTCGA
AG
GAGGAAGTTAAAAAGCTGAAAAAAGAACTGGAAAATTTTGATCCTTCATTTTTTGAAGAAATTGAAGA
C
CTGAAGTATAATTATAAGGAAGAAGTGAAAAAGAATATCCTATTAGAAGAGAAGCTAAAAAAACTGTCG
GAA
CAGTTTGGATTTGAACTGCCTAGTCCTCTTGCTGCTTCTGAACACTCGGAAGATGGAGAAAGTCCTC
AT
AGTTTCCCTATTTATTAG


Translation (2479 aa):
MPPNIKWKELIKVDPDDLPRQEELADKLLISLSKVEVNELKNEDQENMIHLFRITQSLMKMKAQEVELAL
E
EVEKAGEEQAKF
ENQLKTKVMKLENELEMAQQSAGGRDTRFLRDEIRQLEKQLEQKDRELEDMEKELDK
E
KKVNEQ
LALRNEEAENENSKLRRENKRLKKKNEQLRQDIIDYQKQIDSQKESLLSRRGEDSDYRSQLSK
K
NYELVQYLDEIQ
TLTEANEKIEVQNQEMRKNLEESVQEMEKMTDEYNRMKALVHQSDAVMDQIKKENEH
Y
RLQ
VRELTDLLKAKDEEDDPVMMAVNAKVEEWKLILSSKDDEIIEYQQMLQSLRGKLKNAQLDADKSNI
M
ALKQ
GIQERDSQIKMLTEQVEQYTKEMEKNTFIIEDLKNELQKDKGTSNFYQQTHYMKIHSKVQILEEK
T
KEAERIAELAEADAREKDKELVEALKRLKDYES
GVYGLEDAVIEIKNCKAQIKIRDGEMEVLTKEINKL
E
MKINDILDENEALRERA
GLEPKTMIDLTEFRNSKRLKQQQYRAENQVLLKEIESLEEERLDLKRKIRQM
A
QERGKRNAAS
GLTIDDLNLSETFSHENKIEGRKLNFMSLNNMNETQSKNEFLSRELAEKEKDLERSRTV
I
AKFQSK
LKELVEENKQLEEGMKEILQAIKDMPKDSDVKGGETSLIIPSLERLVNAMESKNAEGIFDASL
H
LKAQVDQLTGRNEELRQELRQSRKEAVNYSQQLVKANLK
IDHLEKETDLLRQSAGSNVVYKGIDLPDGI
A
PSSAYIINSQNEYLIHLLQ
ELDNKEKKLKHLEDSLEDYNRKFAVIRHQQSLLYKEYLSEKDIWKTDSEM
I
REEKRKLEDQAEQDAVKVKEYN
NLLSALQMDSNEMKKMLSENSRKITVLQVNEKSLIRQYTTLVEMERH
L
RKENGKHRNDVIAMEAEVTEKLGSLQRFK
EMAIFKIAALQKVIDNSVSLSELELANKQYNELTTKYRDI
L
QKDNMLVQRTSNLEHLE
CENASLKEQMEAISKELEITKEKLHTIEQAWEQETKLGNDSNMDKAKKSMTN
S
DIVSISKKITVLEMKELNERQRAEHCQKMYEHLRTSLKQMEERNFELETKFTE
LTKINLDAQKVEQMLR
D
ELADSVTKAVSDADRQRILELEKSEVELKVEVS
KLREISDIAKRQVDFLNSQQQSREKEVESLRTQLLD
F
Q
AQSDEKALIAKLHQHVVSLQISEATALGKLESVTSKLQKMEAYNLRLEQKLDEKEQALYYARLEGRNR
A
KHLRQTIQSLRRQFSGALPLAQQEKFSKTMIQLQNDKLKIMQEMKNSQQEHRNMENKTLELELKLKGLE
E
LISTLKDARGAQK
VINWHVKIEELRLQELKLNRELVKGKEEIKYLNNIISEYEHTINSLEEEIVQQSKF
H
EERQMAWDQREVELERQLDIFDHQQNEILSAAQK
FEDSTGSMPDPSLPLPNQLEIALRKIKENIQVILK
T
QATCKSLEE
KLKEKESALRLAEQNILSRDKVINELRLRLPATADREKLIAELERKELEPKSHHTMKIAH
Q
TIANMQARLNHKEEVLKKYQHLLEKARE
EQREIVKKHEEDLHVLHHKLEQQADNSLNKFRQTAQDLLKQ
S
PAPVPTNKHFIRLAEMEQTVAEQDDSLSSLLTKLKKVSKDLEKQKEITELKVREFENTKL
RLQETHASE
V
KKVKAEVEDLRHALAQAHKDSQSLKSELQAQKEANSRAPTTTMRNLVDRLKSQLALKEKQQK
ALSRALL
E
LRSEMTAAAEERIIAVTSQKEANLNVQQVVERHTRELK
SQIEDLNENLLKLKEALKTSKNKENSLADDL
N
ELNNELQKKQKAYNKILREKDGIDQENDELRRQIKRLSSGLQ
SKTLIDNKQSLIDELQKKVKKLESQLE
R
KVDDVDIKPVKEK
SSKEELIRWEEGKKWQTKVEGLRNRLKEKEGEAHGLAKQLNTLKELFAKADKEKLT
L
QKKLKTTGMTVDQVLGVRALESEKELEELKKKNLDLENDILYM
RTQQALPRDSVVEDLHLQNKYLQEKL
H
TLEKKLSKEKYSQSL
TSEIESDDHCQKEQELQKENLKLSSENIELKFQLEQANKDLPRLKNQVKDLKEM
C
EFLKKGKLELERKLGQVRG
AGRSGKTIPELEKTIGLMKKVVEKVQRENEQLKKASGILTSEKMATIEEE
N
RNLK
AELEKLKAHFGRQLSMQFESKNKGTEKIVAENERLRKELKKEIEASEKLRIAKNNLELVNDKMAA
Q
LEETGKRLQFAESRAPQLEGADSKSWKSIVVS
RVYETKMKELESDIAKKNQSITDLKQLVREATEREQK
A
KKYTEDLEQQ
IEILKNVPEGAETEQELIRELQLLRLANNQMDKERAELIHQIEINKDQTRADSSIPDSD
Q
LKEKINDLETQLRKLELEKQHSK
EEVKKLKKELENFDPSFFEEIEDLKYNYKEEVKKNILLEEKLKKLS
E
QFGFELPSPLAASEHSEDGESPHSFPIY




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser