NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS47811.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
47811.1 Public Homo sapiens 8 VPS37A 22 109 92 CCDS HistoryNCBI Gene:137492Re-query CCDS DB by CCDS ID:47811.1Re-query CCDS DB by GeneID:137492See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 47811.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000521829.5 ENSP00000429680.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000521829.5Link to Ensembl Protein Viewer:ENSP00000429680.1Re-query CCDS DB by Nucleotide ID:ENST00000521829Re-query CCDS DB by Protein ID:ENSP00000429680
Original member NCBI NM_001145152.1 NP_001138624.1 Updated not alive Link to Nucleotide Sequence:NM_001145152.1Link to Protein Sequence:NP_001138624.1Re-query CCDS DB by Nucleotide ID:NM_001145152Re-query CCDS DB by Protein ID:NP_001138624
Current member NCBI NM_001145152.2 NP_001138624.1 Accepted alive Link to Nucleotide Sequence:NM_001145152.2Link to Protein Sequence:NP_001138624.1Re-query CCDS DB by Nucleotide ID:NM_001145152Re-query CCDS DB by Protein ID:NP_001138624Link to BLAST:NP_001138624.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001138624.1 372 Q8NEZ2-2 372 100% 0 0

Chromosomal Locations for CCDS 47811.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 8 (NC_000008.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 17247245 17247369 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 17268258 17268372 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 17268856 17268956 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 17274733 17274958 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 17276397 17276467 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 17280028 17280155 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 17280239 17280297 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 17280375 17280443 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 17284473 17284616 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 17286347 17286427 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1119 nt):
ATGAGCTGGCTTTTTCCCCTGACCAAGAGCGCCTCCTCCTCCGCGGCTGGGTCCCCCGGTGGCCTCACCA
GC
CTCCAGCAGCAGAAGCAGCGCCTGATCGAGTCCCTCCGGAACTCACACTCCAGATTGCTTCCTCCACA
G
TTTCCTCAGGAAAAACCAGTGATCAGTGTTTATCCACCAATACGACATCACTTAATGGATAAACAAGGA
GTG
TATGTTACCTCTCCATTAGTAAACAATTTTACAATGCACTCAGATCTTGGAAAAATTATTCAGAGTC
TG
TTGGATGAGTTTTGGAAGAATCCTCCAGTTTTAGCTCCTACTTCAACAGCATTTCCTTATCTATACAG
T
AACCCAAGTGGGATGTCTCCTTATGCTTCTCAGGGTTTTCCATTTCTTCCTCCATATCCTCCACAAGAA
GCA
AACAGGAGTATCACTTCTTTATCTGTTGCTGACACTGTTTCTTCTTCAACAACAAGTCATACCACAG
CC
AAGCCTGCCGCTCCTTCATTTGGTGTCCTTTCAAATCTGCCATTACCCATTCCCACAGTGGATGCTTC
A
ATACCGACAAGCCAAAATGGTTTTGGGTACAAGATGCCAGATGTCCCTGATGCATTTCCAGAACTCTCA
GAA
CTAAGTGTGTCACAACTCACAGATATGAATGAACAAGAGGAGGTATTACTAGAACAGTTTCTGACTT
TG
CCTCAACTAAAACAAATTATTACCGACAAAGATGACTTAGTAAAAAGTATTGAGGAACTAGCAAGAAA
A
AATCTCCTTTTGGAGCCCAGCTTGGAAGCCAAAAGACAAACTGTTTTAGATAAGTATGAATTACTTACA
CAG
ATGAAGTCCACTTTCGAAAAGAAGATGCAAAGGCAGCATGAACTTAGTGAGAGCTGTAGTGCAAGTG
CC
CTTCAGGCAAGATTGAAAGTAGCTGCACATGAAGCTGAGGAAGAATCTGATAATATTGCAGAAGACTT
C
TTGGAGGGAAAGATGGAAATAGATGATTTTCTCAGTAGCTTCATGGAAAAGAGAACAATTTGCCACTGT
AGA
AGAGCCAAGGAAGAGAAACTTCAGCAGGCGATAGCAATGCACAGCCAATTTCATGCTCCACTATAG


Translation (372 aa):
MSWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSRLLPPQFPQEKPVISVYPPIRHHLMDKQG
V
YVTSPLVNN
FTMHSDLGKIIQSLLDEFWKNPPVLAPTSTAFPYLYSNPSGMSPYASQGFPFLPPYPPQE
A
NRSITSLSVADTVSSSTTSHTTAKPAAPSFGVLSNLPLPIPTVDASIP
TSQNGFGYKMPDVPDAFPELS
E
L
SVSQLTDMNEQEEVLLEQFLTLPQLKQIITDKDDLVKSIEELARKNLLLEPSLEAKRQTVLDKYELLT
Q
MKSTFEKKMQRQHELSE
SCSASALQARLKVAAHEAEEESDNIAEDFLEGKMEIDDFLSSFMEKRTICHC
R
RAKEEKLQQAIAMHSQFHAPL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser