NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS4760.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
4760.1 Public Homo sapiens 6 HLA-DMB 22 109 92 CCDS HistoryNCBI Gene:3109Re-query CCDS DB by CCDS ID:4760.1Re-query CCDS DB by GeneID:3109See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 4760.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000418107.2 ENSP00000398890.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000418107.2Link to Ensembl Protein Viewer:ENSP00000398890.2Re-query CCDS DB by Nucleotide ID:ENST00000418107Re-query CCDS DB by Protein ID:ENSP00000398890
Original member Current member NCBI NM_002118.4 NP_002109.2 Accepted alive Link to Nucleotide Sequence:NM_002118.4Link to Protein Sequence:NP_002109.2Re-query CCDS DB by Nucleotide ID:NM_002118Re-query CCDS DB by Protein ID:NP_002109Link to BLAST:NP_002109.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_002109.2 263 P28068 263 99.6198% 0 1

Chromosomal Locations for CCDS 4760.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 6 (NC_000006.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 32934971 32934987 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 32935342 32935377 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 32935536 32935652 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 32937172 32937456 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 32938684 32938965 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 32940753 32940807 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (792 nt):
ATGATCACATTCCTGCCGCTGCTGCTGGGGCTCAGCCTGGGCTGCACAGGAGCAGGTGGCTTCGTGGCCC
AT
GTGGAAAGCACCTGTCTGTTGGATGATGCTGGGACTCCAAAGGATTTCACATACTGCATCTCCTTCAA
C
AAGGATCTGCTGACCTGCTGGGATCCAGAGGAGAATAAGATGGCCCCTTGCGAATTTGGGGTGCTGAAT
AGC
TTGGCGAATGTCCTCTCACAGCACCTCAACCAAAAAGACACCCTGATGCAGCGCTTGCGCAATGGGC
TT
CAGAATTGTGCCACACACACCCAGCCCTTCTGGGGATCACTGACCAACAGGACACGGCCACCATCTGT
G
CAAGTAGCCAAAACCACTCCTTTTAACACGAGGGAGCCTGTGATGCTGGCCTGCTATGTGTGGGGCTTC
TAT
CCAGCAGAAGTGACTATCACGTGGAGGAAGAACGGGAAGCTTGTCATGCCTCACAGCAGTGCGCACA
AG
ACTGCCCAGCCCAATGGAGACTGGACATACCAGACCCTCTCCCATTTAGCCTTAACCCCCTCTTACGG
G
GACACTTACACCTGTGTGGTAGAGCACACTGGGGCTCCTGAGCCCATCCTTCGGGACTGGACACCTGGG
CTG
TCCCCCATGCAGACCCTGAAGGTTTCTGTGTCTGCAGTGACTCTGGGCCTGGGCCTCATCATCTTCT
CT
CTTGGTGTGATCAGCTGGCGGAGAGCTGGCCACTCTAGTTACACTCCTCTTCCTGGGTCCAATTATTC
A
GAAGGATGGCACATTTCCTAG


Translation (263 aa):
MITFLPLLLGLSLGCTGAGGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLN
S
LANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRT
RPPSVQVAKTTPFNTREPVMLACYVWGF
Y
PAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHTGAPEPILRDW
TPG
L
SPMQTLKVSVSAVTLGLGLIIFSLGVISWRRAGHS
SYTPLPGSNYSEGWHIS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser