NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS47489.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
47489.1 Public Homo sapiens 6 ADGRG6 22 109 92 CCDS HistoryNCBI Gene:57211Re-query CCDS DB by CCDS ID:47489.1Re-query CCDS DB by GeneID:57211See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 47489.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000367609.7 ENSP00000356581.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000367609.7Link to Ensembl Protein Viewer:ENSP00000356581.3Re-query CCDS DB by Nucleotide ID:ENST00000367609Re-query CCDS DB by Protein ID:ENSP00000356581
Original member Current member NCBI NM_198569.2 NP_940971.1 Accepted alive Link to Nucleotide Sequence:NM_198569.2Link to Protein Sequence:NP_940971.1Re-query CCDS DB by Nucleotide ID:NM_198569Re-query CCDS DB by Protein ID:NP_940971Link to BLAST:NP_940971.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_940971.1 1250 Q86SQ4-3 1250 99.92% 0 1

Chromosomal Locations for CCDS 47489.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 6 (NC_000006.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 142302330 142302331 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 142309544 142309644 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 142367569 142367910 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 142370170 142370793 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 142381951 142382019 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 142383760 142383843 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 142390258 142390343 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 142392948 142393000 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 142393896 142393958 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 142397613 142397755 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 142400485 142400596 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 142401994 142402058 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 142402620 142402830 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 142403802 142403973 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 142405688 142405828 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 142408150 142408269 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 142409874 142409919 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 142411305 142411411 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 142414969 142415096 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 142415796 142416064 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 142417273 142417369 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 142419821 142420104 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 142437434 142437535 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 142438212 142438364 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 142443337 142443515 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3753 nt):
ATGATGTTTCGCTCAGATCGAATGTGGAGCTGCCATTGGAAATGGAAGCCCAGTCCTCTCCTGTTCTTAT
TT
GCTTTATATATCATGTGTGTTCCTCACTCAGTGTGGGGATGTGCCAACTGCCGAGTGGTTTTGTCCAA
C
CCTTCTGGGACCTTTACTTCTCCATGCTACCCTAACGACTACCCAAACAGCCAGGCTTGCATGTGGACG
CTC
CGAGCCCCCACCGGTTATATCATTCAGATAACATTTAACGACTTTGACATTGAAGAAGCTCCCAATT
GC
ATTTATGACTCATTATCCCTTGATAATGGAGAGAGCCAGACTAAATTTTGTGGAGCAACTGCCAAAGG
C
CTATCATTTAACTCAAGTGCGAATGAGATGCATGTGTCCTTTTCAAGTGACTTTAGCATCCAGAAGAAA
GGT
TTCAATGCCAGCTACATCAGAGTTGCCGTGTCCTTAAGGAATCAAAAGGTCATTTTACCCCAGACAT
CA
GATGCTTACCAGGTATCTGTTGCAAAAAGCATCTCTATTCCAGAGCTCAGTGCTTTCACACTCTGCTT
T
GAAGCAACCAAAGTTGGCCATGAAGACAGTGATTGGACAGCTTTCTCCTACTCAAATGCATCCTTCACA
CAA
TTGCTCAGTTTTGGAAAGGCCAAGAGTGGCTACTTTCTATCCATTTCTGATTCAAAATGTTTGTTGA
AT
AATGCATTACCTGTCAAAGAAAAAGAAGACATTTTTGCAGAAAGCTTTGAACAGCTCTGCCTTGTTTG
G
AATAATTCTTTGGGCTCTATTGGTGTAAATTTCAAAAGAAACTATGAAACAGTTCCATGTGATTCTACC
ATT
AGTAAAGTTATTCCTGGGAATGGGAAATTGTTGTTGGGCTCCAATCAAAATGAAATTGTCTCTCTAA
AA
GGGGACATTTATAACTTTCGACTTTGGAATTTTACCATGAATGCCAAAATCCTCTCCAACCTCAGCTG
T
AATGTGAAAGGGAATGTAGTCGACTGGCAAAATGACTTCTGGAATATCCCAAACCTAGCTCTGAAAGCT
GAA
AGCAACCTAAGCTGTGGTTCCTACCTGATCCCGCTCCCAGCAGCAGAACTGGCCAGCTGTGCAGACC
TG
GGGACCCTCTGTCAAGCTACTGTAAACTCTCCTAGTACTACACCACCCACTGTCACCACTAACATGCC
T
GTTACTAACAGAATCGATAAACAAAGGAATGATGGAATTATCTATAGAATATCCGTAGTGATTCAGAAC
ATC
CTTCGTCACCCTGAGGTAAAAGTACAGAGCAAGGTGGCAGAATGGCTCAATTCAACCTTCCAAAATT
GG
AACTACACGGTTTATGTCGTTAATATCAGTTTTCACCTGAGTGCTGGAGAGGACAAGATTAAAGTCAA
G
AGAAGCCTTGAGGATGAGCCAAGGTTGGTGCTTTGGGCCCTTCTAGTTTACAATGCTACCAACAATACT
AAT
TTGGAAGGAAAAATCATTCAGCAGAAGCTCCTAAAAAATAATGAGTCCTTGGATGAAGGCTTGAGGC
TA
CATACAGTGAATGTGAGACAACTGGGTCATTGTCTTGCCATGGAGGAACCCAAAGGCTACTACTGGCC
A
TCTATCCAACCTTCTGAATACGTTCTTCCTTGTCCAGACAAGCCTGGCTTTTCTGCTTCTCGGATATGT
TTT
TACAATGCTACCAACCCATTGGTAACCTACTGGGGACCTGTTGATATCTCCAACTGTTTAAAAGAAG
CA
AATGAAGTTGCTAACCAGATTTTAAATTTAACTGCTGATGGGCAGAACTTAACCTCAGCCAATATTAC
C
AACATTGTGGAACAGGTCAAAAGAATTGTGAATAAAGAAGAAAACATTGATATAACACTTGGCTCAACT
CTA
ATGAATATATTTTCTAATATCTTAAGCAGTTCAGACAGTGACTTGCTTGAGTCATCTTCTGAAGCTT
TA
AAAACAATTGATGAATTGGCCTTCAAGATAGACCTAAATAGCACATCACATGTGAATATTACAACTCG
G
AACTTGGCTCTCAGCGTATCATCCCTGTTACCAGGGACAAATGCAATTTCAAATTTTAGCATTGGTCTT
CCA
AGCAATAATGAATCGTATTTCCAGATGGATTTTGAGAGTGGACAAGTGGATCCACTGGCATCTGTAA
TT
TTGCCTCCAAACTTACTTGAGAATTTAAGTCCAGAAGATTCTGTATTAGTTAGAAGAGCACAGTTTAC
T
TTCTTCAACAAAACTGGACTTTTCCAGGATGTAGGACCCCAAAGAAAAACTTTAGTGAGTTATGTGATG
GCG
TGCAGTATTGGAAACATTACTATCCAGAATCTGAAGGATCCTGTTCAAATAAAAATCAAACATACAA
GA
ACTCAGGAAGTGCATCATCCCATCTGTGCCTTCTGGGATCTGAACAAAAACAAAAGTTTTGGAGGATG
G
AACACGTCAGGATGTGTTGCACACAGAGATTCAGATGCAAGTGAGACAGTCTGCCTGTGTAACCACTTC
ACA
CACTTTGGAGTTCTGATGGACCTTCCAAGAAGTGCCTCACAGTTAGATGCAAGAAACACTAAAGTCC
TC
ACTTTCATCAGCTATATTGGGTGTGGAATATCTGCTATTTTTTCAGCAGCAACTCTCCTGACATATGT
T
GCTTTTGAGAAATTGCGAAGGGATTATCCCTCCAAAATCTTGATGAACCTGAGCACAGCCCTGCTGTTC
CTG
AATCTCCTCTTCCTCCTAGATGGCTGGATCACCTCCTTCAATGTGGATGGACTTTGCATTGCTGTTG
CA
GTCCTGTTGCATTTCTTCCTTCTGGCAACCTTTACCTGGATGGGGCTAGAAGCAATTCACATGTACAT
T
GCTCTAGTTAAAGTATTTAACACTTACATTCGCCGATACATTCTAAAATTCTGCATCATTGGCTGGGGT
TTG
CCTGCCTTAGTGGTGTCAGTTGTTCTAGCGAGCAGAAACAACAATGAAGTCTATGGAAAAGAAAGTT
AT
GGGAAAGAAAAAGGTGATGAATTCTGTTGGATTCAAGATCCAGTCATATTTTATGTGACCTGTGCTGG
G
TATTTTGGAGTCATGTTTTTTCTGAACATTGCCATGTTCATTGTGGTAATGGTGCAGATCTGTGGGAGG
AAT
GGCAAGAGAAGCAACCGGACCCTGAGAGAAGAAGTGTTAAGGAACCTGCGCAGTGTGGTTAGCTTGA
CC
TTTCTGTTGGGCATGACATGGGGTTTTGCATTCTTTGCCTGGGGACCCTTAAATATCCCCTTCATGTA
C
CTCTTCTCCATCTTCAATTCATTACAAGGCTTATTTATATTCATCTTCCACTGTGCTATGAAGGAGAAT
GTT
CAGAAACAGTGGCGGCAGCATCTCTGCTGTGGTAGATTTCGGTTAGCAGATAACTCAGATTGGAGTA
AG
ACAGCTACCAATATCATCAAGAAAAGTTCTGATAATCTAGGAAAATCTTTGTCTTCAAGCTCCATTGG
T
TCCAACTCAACCTATCTTACATCCAAATCTAAATCCAGCTCTACCACCTATTTCAAAAGGAATAGCCAC
ACA
GACAGTGCTTCCATGGACAAGTCCTTGTCAAAACTGGCCCATGCTGATGGAGATCAAACATCAATCA
TC
CCTGTCCATCAGGTCATTGATAAGGTCAAGGGTTATTGCAATGCTCATTCAGACAACTTCTATAAAAA
T
ATTATCATGTCAGACACCTTCAGCCACAGCACAAAGTTTTAA


Translation (1250 aa):
MMFRSDRMWSCHWKWKPSPLLFLFALYIMCVPHSVWGCANCRVVLSNPSGTFTSPCYPNDYPNSQACMWT
L
RAPTGYIIQITFNDFDIEEAPNCIYDSLSLDNGESQTKFCGATAKGLSFNSSANEMHVSFSSDFSIQKK
G
FNASYIR
VAVSLRNQKVILPQTSDAYQVSVAKSISIPELSAFTLCFEATKVGHEDSDWTAFSYSNASFT
Q
LLSFGKAKSGYFLSISDSKCLLNNALPVKEKEDIFAESFEQLCLVWNNSLGSIGVNFKRNYETVPCDST
I
SKVIPGNGKLLLGSNQNEIVSLKGDIYNFRLWNFTMNAKILSNLSCNVKGNVVDWQNDFWNIPNLALKA
E
SNLSC
GSYLIPLPAAELASCADLGTLCQATVNSPSTTPPTVTTNMPVTNRIDKQRNDGIIYRISVVIQN
I
LRHPEVKVQSKVAEW
LNSTFQNWNYTVYVVNISFHLSAGEDKIKVKRSLEDEPRLVLWALLVYNATNNT
N
LEGKIIQQKLLKNNESLDEGLRLHTVNVRQL
GHCLAMEEPKGYYWPSIQPSEYVLPCPDKPGFSASRIC
F
YNATNPLVTYWGPVDISNCL
KEANEVANQILNLTADGQNLTSANITNIVEQVKRIVNKEENIDITLGST
L
MNIFSNILSSSDSDLLESSS
EALKTIDELAFKIDLNSTSHVNITTRNLALSVSSLLPGTNAISNFSIGL
P
SNNESYFQ
MDFESGQVDPLASVILPPNLLENLSPEDSVLVRRAQFTFFNKTGLFQDVGPQRKTLVSYVM
A
CSIGNITIQNLKDPVQIKIKHTRTQ
EVHHPICAFWDLNKNKSFGGWNTSGCVAHRDSDASETVCLCNHF
T
HFGVLM
DLPRSASQLDARNTKVLTFISYIGCGISAIFSAATLLTYVAFEKLRRDYPSKILMNLSTALLF
L
NLLFLLDGWITSFNVDGLCIAVAVLLHFFLLATFTWMGLEAIHMYIALVKVFNTYIRRYILKFCIIGW
G
L
PALVVSVVLASRNNNEVYGKESYGKEKGDE
FCWIQDPVIFYVTCAGYFGVMFFLNIAMFIVVMVQICGR
N
GKRSNRTLREEVLRNLRSVVSLTFLLGMTWGFAFFAWGPLNIPFMYLFSIFNSLQ
GLFIFIFHCAMKEN
V
QKQWRQHLCCGRFRLADNS
DWSKTATNIIKKSSDNLGKSLSSSSIGSNSTYLTSKSKSSSTTYFKRNSH
T
DSASMDKSLSKLAHADGDQTSIIPVHQVIDKVKGYCNAHSDNFYKNIIMSDTFSHSTKF



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser