NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS47154.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
47154.1 Public Homo sapiens 4 GUCY1B1 22 109 92 CCDS HistoryNCBI Gene:2983Re-query CCDS DB by CCDS ID:47154.1Re-query CCDS DB by GeneID:2983See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 47154.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000264424.12 ENSP00000264424.8 Accepted alive Link to Ensembl Transcript Viewer:ENST00000264424.12Link to Ensembl Protein Viewer:ENSP00000264424.8Re-query CCDS DB by Nucleotide ID:ENST00000264424Re-query CCDS DB by Protein ID:ENSP00000264424
Original member Current member NCBI NM_000857.3 NP_000848.1 Accepted alive Link to Nucleotide Sequence:NM_000857.3Link to Protein Sequence:NP_000848.1Re-query CCDS DB by Nucleotide ID:NM_000857Re-query CCDS DB by Protein ID:NP_000848Link to BLAST:NP_000848.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000848.1 619 Q02153-1 619 100% 0 0

Chromosomal Locations for CCDS 47154.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 4 (NC_000004.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 155759141 155759143 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 155759787 155759860 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 155774968 155775068 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 155777524 155777642 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 155789714 155789911 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 155793856 155794086 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 155795341 155795457 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 155796377 155796510 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 155799877 155800074 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 155802342 155802579 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 155803624 155803764 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 155804593 155804747 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 155805103 155805229 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 155806386 155806409 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1860 nt):
ATGTACGGATTTGTGAATCACGCCCTGGAGTTGCTGGTGATCCGCAATTACGGCCCCGAGGTGTGGGAAG
AC
ATCAAAAAAGAGGCACAGTTAGATGAAGAAGGACAGTTTCTTGTCAGAATAATATATGATGACTCCAA
A
ACTTATGATTTGGTTGCTGCTGCAAGCAAAGTCCTCAATCTCAATGCTGGAGAAATCCTCCAAATGTTT
GGG
AAGATGTTTTTCGTCTTTTGCCAAGAATCTGGTTATGATACAATCTTGCGTGTCCTGGGCTCTAATG
TC
AGAGAATTTCTACAGAACCTTGATGCTCTGCACGACCACCTTGCTACCATCTACCCAGGAATGCGTGC
A
CCTTCCTTTAGGTGCACTGATGCAGAAAAGGGCAAAGGACTCATTTTGCACTACTACTCAGAGAGAGAA
GGA
CTTCAGGATATTGTCATTGGAATCATCAAAACAGTGGCACAACAAATCCATGGCACTGAAATAGACA
TG
AAGGTTATTCAGCAAAGAAATGAAGAATGTGATCATACTCAATTTTTAATTGAAGAAAAAGAGTCAAA
A
GAAGAGGATTTTTATGAAGATCTTGACAGATTTGAAGAAAATGGTACCCAGGAATCACGCATCAGCCCA
TAT
ACATTCTGCAAAGCTTTTCCTTTTCATATAATATTTGACCGGGACCTAGTGGTCACTCAGTGTGGCA
AT
GCTATATACAGAGTTCTCCCCCAGCTCCAGCCTGGGAATTGCAGCCTTCTGTCTGTCTTCTCGCTGGT
T
CGTCCTCATATTGATATTAGTTTCCATGGGATCCTTTCTCACATCAATACTGTTTTTGTATTGAGAAGC
AAG
GAAGGATTGTTGGATGTGGAGAAATTAGAATGTGAGGATGAACTGACTGGGACTGAGATCAGCTGCT
TA
CGTCTCAAGGGTCAAATGATCTACTTACCTGAAGCAGATAGCATACTTTTTCTATGTTCACCAAGTGT
C
ATGAACCTGGACGATTTGACAAGGAGAGGGCTGTATCTAAGTGACATCCCTCTGCATGATGCCACGCGC
GAT
CTTGTTCTTTTGGGAGAACAATTTAGAGAGGAATACAAACTCACCCAAGAACTGGAAATCCTCACTG
AC
AGGCTACAGCTCACGTTAAGAGCCCTGGAAGATGAAAAGAAAAAGACAGACACATTGCTGTATTCTGT
C
CTTCCTCCGTCTGTTGCCAATGAGCTGCGGCACAAGCGTCCAGTGCCTGCCAAAAGATATGACAATGTG
ACC
ATCCTCTTTAGTGGCATTGTGGGCTTCAATGCTTTCTGTAGCAAGCATGCATCTGGAGAAGGAGCCA
TG
AAGATCGTCAACCTCCTCAACGACCTCTACACCAGATTTGACACACTGACTGATTCCCGGAAAAACCC
A
TTTGTTTATAAGGTGGAGACTGTTGGTGACAAGTATATGACAGTGAGTGGTTTACCAGAGCCATGCATT
CAC
CATGCACGATCCATCTGCCACCTGGCCTTGGACATGATGGAAATTGCTGGCCAGGTTCAAGTAGATG
GT
GAATCTGTTCAGATAACAATAGGGATACACACTGGAGAGGTAGTTACAGGTGTCATAGGACAGCGGAT
G
CCTCGATACTGTCTTTTTGGGAATACTGTCAACCTCACAAGCCGAACAGAAACCACAGGAGAAAAGGGA
AAA
ATAAATGTGTCTGAATATACATACAGATGTCTTATGTCTCCAGAAAATTCAGATCCACAATTCCACT
TG
GAGCACAGAGGCCCAGTGTCCATGAAGGGCAAAAAAGAACCAATGCAAGTTTGGTTTCTATCCAGAAA
A
AATACAGGAACAGAGGAAACAAAGCAGGATGATGACTGA


Translation (619 aa):
MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMF
G
KMFFVFCQESGYDTILRVLGSNVREFLQ
NLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSERE
G
LQDIVIGIIKTVAQQIHGTEIDMK
VIQQRNEECDHTQFLIEEKESKEEDFYEDLDRFEENGTQESRISP
Y
TFCKAFPFHIIFDRDLVVTQCGNAIYRVLPQ
LQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVLRS
K
EGLLDVEKLECEDELTGTEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATR
D
LVLLGEQFREEYKLTQELEILTDRLQLTLRALEDEKKKTD
TLLYSVLPPSVANELRHKRPVPAKRYDNV
T
ILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYK
VETVGDKYMTVSGLPEPCI
H
HARSICHLALDMMEIAGQVQVDGESVQ
ITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKG
K
INVSEYTY
RCLMSPENSDPQFHLEHRGPVSMKGKKEPMQVWFLSRKNTGTEETKQDDD



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser