NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS47054.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
47054.1 Public Homo sapiens 4 USP46 22 109 92 CCDS HistoryNCBI Gene:64854Re-query CCDS DB by CCDS ID:47054.1Re-query CCDS DB by GeneID:64854See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 47054.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000508499.5 ENSP00000423244.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000508499.5Link to Ensembl Protein Viewer:ENSP00000423244.1Re-query CCDS DB by Nucleotide ID:ENST00000508499Re-query CCDS DB by Protein ID:ENSP00000423244
Original member NCBI NM_001134223.1 NP_001127695.1 Updated not alive Link to Nucleotide Sequence:NM_001134223.1Link to Protein Sequence:NP_001127695.1Re-query CCDS DB by Nucleotide ID:NM_001134223Re-query CCDS DB by Protein ID:NP_001127695
Current member NCBI NM_001134223.2 NP_001127695.1 Accepted alive Link to Nucleotide Sequence:NM_001134223.2Link to Protein Sequence:NP_001127695.1Re-query CCDS DB by Nucleotide ID:NM_001134223Re-query CCDS DB by Protein ID:NP_001127695Link to BLAST:NP_001127695.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001127695.1 359 P62068-3 359 100% 0 0

Chromosomal Locations for CCDS 47054.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 4 (NC_000004.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 52597640 52597741 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 52598628 52598706 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 52601857 52602054 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 52604501 52604584 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 52610541 52610617 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 52626018 52626247 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 52627950 52628163 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 52631064 52631144 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 52656296 52656310 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1080 nt):
ATGAATTGTTTTCAGGGCACCAATGCCTCTGCTCTGGAAAAAGACATTGGTCCAGAGCAGTTTCCAATCA
AT
GAACACTATTTCGGATTGGTCAATTTTGGAAACACATGCTACTGTAACTCCGTGCTTCAGGCATTGTA
C
TTCTGCCGTCCATTCCGGGAGAATGTGTTGGCATACAAGGCCCAGCAAAAGAAGAAGGAAAACTTGCTG
ACG
TGCCTGGCGGACCTTTTCCACAGCATTGCCACACAGAAGAAGAAGGTTGGCGTCATCCCACCAAAGA
AG
TTCATTTCAAGGCTGAGAAAAGAGAATGATCTCTTTGATAACTACATGCAGCAGGATGCTCATGAATT
T
TTAAATTATTTGCTAAACACTATTGCGGACATCCTTCAGGAGGAGAAGAAACAGGAAAAACAAAATGGA
AAA
TTAAAAAATGGCAACATGAACGAACCTGCGGAAAATAATAAACCAGAACTCACCTGGGTCCATGAGA
TT
TTTCAGGGAACGCTTACCAATGAAACTCGATGCTTGAACTGTGAAACTGTTAGTAGCAAAGATGAAGA
T
TTTCTTGACCTTTCTGTTGATGTGGAGCAGAATACATCCATTACCCACTGTCTAAGAGACTTCAGCAAC
ACA
GAAACACTGTGTAGTGAACAAAAATATTATTGTGAAACATGCTGCAGCAAACAAGAAGCCCAGAAAA
G
G
ATGAGGGTAAAAAAGCTGCCCATGATCTTGGCCCTGCACCTAAAGCGGTTCAAGTACATGGAGCAGCT
G
CACAGATACACCAAGCTGTCTTACCGTGTGGTCTTCCCTCTGGAACTCCGGCTCTTCAACACCTCCAGT
GAT
GCAGTGAACCTGGACCGCATGTATGACTTGGTTGCGGTGGTCGTTCACTGTGGCAGTGGTCCTAATC
GT
GGGCATTATATCACTATTGTGAAAAGTCACGGCTTCTGGCTTTTGTTTGATGATGACATTGTAGAGAA
A
ATAGATGCTCAAGCTATTGAAGAATTCTATGGCCTGACGTCAGATATATCAAAAAATTCAGAATCTGGA
TAT
ATTTTATTCTATCAGTCAAGAGAGTAA


Translation (359 aa):
MNCFQGTNASALEKDIGPEQFPINEHYFGLVNFGNTCYCNSVLQALYFCRPFRENVLAYKAQQKKKENLL
T
CLADLFHSIATQKKKVGVIPPKKFISRLRKEN
DLFDNYMQQDAHEFLNYLLNTIADILQEEKKQEKQNG
K
LKNGNMNEPAENNKPELTWVHEIFQGTLTNETRCLNCET
VSSKDEDFLDLSVDVEQNTSITHCLRDFSN
T
ETLCSEQKYYCETCCSKQEAQK
RMRVKKLPMILALHLKRFKYMEQLHRYTKLSYRVVFPLELRLFNTSS
D
AVNLDRMYDLVAVVVHCG
SGPNRGHYITIVKSHGFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSESG
Y
ILFYQSRE




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser