NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS46794.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
46794.1 Public Homo sapiens 3 ACAA1 22 109 92 CCDS HistoryNCBI Gene:30Re-query CCDS DB by CCDS ID:46794.1Re-query CCDS DB by GeneID:30See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 46794.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000301810.11 ENSP00000301810.7 Accepted alive Link to Ensembl Transcript Viewer:ENST00000301810.11Link to Ensembl Protein Viewer:ENSP00000301810.7Re-query CCDS DB by Nucleotide ID:ENST00000301810Re-query CCDS DB by Protein ID:ENSP00000301810
Original member NCBI NM_001130410.1 NP_001123882.1 Updated not alive Link to Nucleotide Sequence:NM_001130410.1Link to Protein Sequence:NP_001123882.1Re-query CCDS DB by Nucleotide ID:NM_001130410Re-query CCDS DB by Protein ID:NP_001123882
Current member NCBI NM_001130410.2 NP_001123882.1 Accepted alive Link to Nucleotide Sequence:NM_001130410.2Link to Protein Sequence:NP_001123882.1Re-query CCDS DB by Nucleotide ID:NM_001130410Re-query CCDS DB by Protein ID:NP_001123882Link to BLAST:NP_001123882.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001123882.1 331 P09110-2 331 100% 0 0

Chromosomal Locations for CCDS 46794.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 3 (NC_000003.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 38123047 38123122 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 38125565 38125710 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 38125826 38125881 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 38126510 38126700 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 38127786 38127866 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 38131596 38131638 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 38131926 38132005 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 38133952 38134009 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 38136592 38136685 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 38136865 38137035 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (996 nt):
ATGCAGAGGCTGCAGGTAGTGCTGGGCCACCTGAGGGGTCCGGCCGATTCCGGCTGGATGCCGCAGGCCG
CG
CCTTGCCTGAGCGGTGCCCCGCAGGCCTCGGCCGCGGACGTGGTGGTGGTGCACGGGCGGCGCACGGC
C
ATCTGCCGGGCGGGCCGCGGCGGCTTCAAGGACACCACCCCCGACGAGCTTCTCTCGGCAGTCATGACC
GCG
GTTCTCAAGGACGTGAATCTGAGGCCGGAACAGCTGGGGGACATCTGTGTCGGAAATGTGCTGCAGC
CT
GGGGCCGGGGCAATCATGGCCCGAATCGCCCAGTTTCTGAGTGACATCCCGGAGACTGTGCCTTTGTC
C
ACTGTCAATAGACAGTGTTCGTCGGGGCTACAGGCAGTGGCCAGCATAGCAGGTGGCATCAGAAATGGG
TCT
TATGACATTGGCATGGCCTGTGGGATAACCTCTGAGAATGTGGCTGAGCGGTTTGGCATTTCACGGG
AG
AAGCAGGATACCTTTGCCCTGGCTTCCCAGCAGAAGGCAGCAAGAGCCCAGAGCAAGGGCTGTTTCCA
A
GCTGAGATTGTGCCTGTGACCACCACGGTCCATGATGACAAGGGCACCAAGAGGAGCATCACTGTGACC
CAG
GATGAGGGTATCCGCCCCAGCACCACCATGGAGGGCCTGGCCAAACTGAAGCCTGCCTTCAAGAAAG
AT
GGTTCTACCACAGCTGGGCTGACAGTGAGTGACGTGGACATCTTCGAGATCAATGAGGCCTTTGCAAG
C
CAGGCTGCCTACTGTGTGGAGAAGCTACGACTCCCCCCTGAGAAGGTGAACCCCCTGGGGGGTGCAGTG
GCC
TTAGGGCACCCACTGGGCTGCACTGGGGCACGACAGGTCATCACGCTGCTCAATGAGCTGAAGCGCC
GT
GGGAAGAGGGCATACGGAGTGGTGTCCATGTGCATCGGGACTGGAATGGGAGCCGCTGCCGTCTTTGA
A
TACCCTGGGAACTGA


Translation (331 aa):
MQRLQVVLGHLRGPADSGWMPQAAPCLSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMT
A
VLKDVNLRPEQLGDICV
GNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNG
S
YDIGMAC
GITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVT
Q
DEGIRPSTTMEGLAKLKPAFKKDGSTTA
GLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAV
A
LGHPLGCTGARQVITLLNELKRRGK
RAYGVVSMCIGTGMGAAAVFEYPGN



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser