NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS46687.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
46687.1 Public Homo sapiens 22 INPP5J 22 109 92 CCDS HistoryNCBI Gene:27124Re-query CCDS DB by CCDS ID:46687.1Re-query CCDS DB by GeneID:27124See the combined annotation on chromosome 22 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 46687.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000404390.7 ENSP00000384534.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000404390.7Link to Ensembl Protein Viewer:ENSP00000384534.3Re-query CCDS DB by Nucleotide ID:ENST00000404390Re-query CCDS DB by Protein ID:ENSP00000384534
Original member Current member NCBI NM_001002837.2 NP_001002837.1 Accepted alive Link to Nucleotide Sequence:NM_001002837.2Link to Protein Sequence:NP_001002837.1Re-query CCDS DB by Nucleotide ID:NM_001002837Re-query CCDS DB by Protein ID:NP_001002837Link to BLAST:NP_001002837.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001002837.1 638 Q15735-3 638 100% 0 0

Chromosomal Locations for CCDS 46687.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 22 (NC_000022.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22See the combined annotation on chromosome 22 in Sequence Viewer

Chromosome Start Stop Links
22 31123015 31123119 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 31124845 31124906 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 31126376 31126489 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 31126613 31126721 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 31126921 31127037 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 31127357 31127532 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 31127951 31128062 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 31128214 31128323 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 31128471 31128654 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 31133098 31133235 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 31133406 31133483 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 31133610 31133714 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 31133913 31134419 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1917 nt):
ATGGAGGGCCAGAGCAGCAGGGGCAGCAGGAGGCCAGGGACCCGGGCTGGCCTGGGTTCCCTGCCCATGC
CC
CAGGGTGTTGCCCAAACTGGGGCACCCTCCAAGGTGGACTCAAGTTTTCAGCTCCCAGCAAAGAAGAA
C
GCAGCCCTAGGACCCTCGGAACCAAGGATCACTGTGGTCACATGGAACGTGGGCACTGCCATGCCCCCA
GAC
GATGTCACATCCCTCCTCCACCTGGGCGGTGGTGACGACAGCGACGGCGCAGACATGATCGCCATAG
G
G
TTGCAGGAAGTGAACTCCATGCTCAACAAGCGACTCAAGGACGCCCTCTTCACGGACCAGTGGAGTGA
G
CTGTTCATGGATGCGCTAGGGCCCTTCAACTTCGTGCTGGTGAGTTCGGTGAGGATGCAGGGTGTCATC
CTG
CTGCTGTTCGCCAAGTACTACCACCTGCCCTTCCTGCGAGACGTGCAGACCGACTGCACGCGCACTG
GC
CTGGGCGGCTACTGGGGTAACAAGGGTGGCGTGAGCGTGCGCCTGGCGGCCTTCGGGCACATGCTCTG
C
TTCCTGAACTGCCACTTGCCTGCGCATATGGACAAGGCGGAGCAGCGCAAAGACAACTTCCAGACCATC
CTC
AGCCTCCAGCAGTTCCAAGGGCCGGGCGCACAGGGCATCCTGGATCATGACCTCGTGTTCTGGTTCG
GG
GACCTGAACTTCCGCATTGAGAGCTATGACCTGCACTTTGTCAAGTTTGCCATCGACAGTGACCAGCT
C
CATCAGCTCTGGGAGAAGGACCAGCTCAACATGGCCAAGAACACCTGGCCCATTCTGAAGGGCTTTCAG
GAG
GGGCCCCTCAACTTCGCTCCCACCTTCAAGTTTGATGTGGGTACCAACAAATACGATACCAGTGCCA
AG
AAACGGAAGCCAGCTTGGACAGACCGTATCCTATGGAAGGTCAAGGCTCCAGGTGGGGGTCCCAGCCC
C
TCAGGACGGAAGAGCCACCGACTCCAGGTGACGCAGCACAGCTACCGCAGCCACATGGAATACACAGTC
AGC
GACCACAAGCCTGTGGCTGCCCAGTTCCTCCTGCAGTTTGCCTTCAGGGACGACATGCCACTGGTGC
GG
CTGGAGGTGGCAGATGAGTGGGTGCGGCCCGAGCAGGCGGTGGTGAGGTACCGCATGGAAACAGTGTT
C
GCCCGCAGCTCCTGGGACTGGATCGGCTTATACCGGGTGGGTTTCCGCCATTGCAAGGACTATGTGGCT
TAT
GTCTGGGCCAAACATGAAGATGTGGATGGGAATACCTACCAGGTAACATTCAGTGAGGAATCACTGC
CC
AAGGGCCATGGAGACTTCATCCTGGGCTACTATAGTCACAACCACAGCATCCTCATCGGCATCACTGA
A
CCCTTCCAGATCTCGCTGCCTTCCTCGGAGTTGGCCAGCAGCAGCACAGACAGCTCAGGCACCAGCTCA
GAG
GGAGAGGATGACAGCACACTGGAGCTCCTTGCACCCAAGTCCCGCAGCCCCAGTCCTGGCAAGTCCA
AG
CGACACCGCAGCCGCAGCCCGGGACTGGCCAGGTTCCCTGGGCTTGCCCTACGGCCCTCATCCCGTGA
A
CGCCGTGGTGCCAGCCGTAGCCCCTCACCCCAGAGCCGCCGCCTGTCCCGAGTGGCTCCTGACAGGAGC
AGT
AATGGCAGCAGCCGGGGCAGTAGTGAAGAGGGGCCCTCTGGGTTGCCTGGCCCCTGGGCCTTCCCAC
CA
GCTGTGCCTCGAAGCCTGGGCCTGTTGCCCGCCTTGCGCCTAGAGACTGTAGACCCTGGTGGTGGTGG
C
TCCTGGGGACCTGATCGGGAGGCCCTGGCGCCCAACAGCCTGTCTCCTAGTCCCCAGGGCCATCGGGGG
CTG
GAGGAAGGGGGCCTGGGGCCCTGA


Translation (638 aa):
MEGQSSRGSRRPGTRAGLGSLPMPQGVAQTGAPSKVDSSFQLPAKKNAALGPSEPRITVVTWNVGTAMPP
D
DVTSLLHLGGGDDSDGADMIAI
GLQEVNSMLNKRLKDALFTDQWSELFMDALGPFNFVLVSSVRMQGVI
L
LLFAKYYHLPFLRDVQTDCTRTGLGGYW
GNKGGVSVRLAAFGHMLCFLNCHLPAHMDKAEQRKDNFQTI
L
SLQQFQGPGAQGILDH
DLVFWFGDLNFRIESYDLHFVKFAIDSDQLHQLWEKDQLNMAKNTWPILKGFQ
E
GPLNFAPTFKFDVGTNKYDT
SAKKRKPAWTDRILWKVKAPGGGPSPSGRKSHRLQVTQHSYRSHMEYTV
S
DHKPVAAQFLLQ
FAFRDDMPLVRLEVADEWVRPEQAVVRYRMETVFARSSWDWIGLYRVGFRHCKDYVA
Y
VWAKHEDVDGNTYQ
VTFSEESLPKGHGDFILGYYSHNHSILIGITEPFQISLPSSELASSSTDSSGTSS
E
GEDDSTLELLAPKSRSPSPGKSKRHRSRSPGLARFPGLALRPSSRERRGASRSPSPQSRRLSRVAPDRS
S
NGSSRGSSEEGPSGLPGPWAFPPAVPRSLGLLPALRLETVDPGGGGSWGPDREALAPNSLSPSPQGHRG
L
EEGGLGP




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser