NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS46621.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
46621.1 Public Homo sapiens 20 NPEPL1 24 110 108 CCDS HistoryNCBI Gene:79716Re-query CCDS DB by CCDS ID:46621.1Re-query CCDS DB by GeneID:79716See the combined annotation on chromosome 20 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 46621.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000356091.11 ENSP00000348395.6 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000356091.11Link to Ensembl Protein Viewer:ENSP00000348395.6Re-query CCDS DB by Nucleotide ID:ENST00000356091Re-query CCDS DB by Protein ID:ENSP00000348395
Original member Current member NCBI NM_024663.4 NP_078939.3 MANE Select Accepted alive Link to Nucleotide Sequence:NM_024663.4Link to Protein Sequence:NP_078939.3Re-query CCDS DB by Nucleotide ID:NM_024663Re-query CCDS DB by Protein ID:NP_078939Link to BLAST:NP_078939.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_078939.3 523 Q8NDH3-1 523 100% 0 0

Chromosomal Locations for CCDS 46621.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 20 (NC_000020.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20See the combined annotation on chromosome 20 in Sequence Viewer

Chromosome Start Stop Links
20 58692901 58693050 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 58693737 58693922 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 58694422 58694592 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 58698684 58698773 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 58699197 58699278 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 58701016 58701158 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 58707123 58707200 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 58712479 58712579 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 58713420 58713543 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 58713917 58714093 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 58714560 58714670 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 58715168 58715326 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1572 nt):
ATGGCGAACGTGGGGCTGCAGTTCCAGGCGAGCGCGGGGGACTCGGACCCACAGAGCCGGCCCCTGCTGC
TG
CTCGGGCAGCTGCACCACCTGCACCGCGTGCCCTGGAGCCACGTCCGCGGGAAGCTGCAGCCCCGGGT
C
ACCGAGGAGCTCTGGCAGGCTGCCCTGAGCACGCTCAACCCCAACCCCACGGACAGCTGTCCCCTCTAC
CTG
AACTACGCCACCGTGGCTGCCCTGCCCTGCAGGGTGAGCCGGCACAACAGCCCCTCGGCCGCCCACT
TC
ATCACGCGGCTGGTGCGGACCTGCCTGCCGCCCGGAGCGCATCGCTGCATTGTGATGGTCTGCGAGCA
G
CCGGAGGTCTTTGCTTCCGCCTGTGCCCTGGCCCGGGCCTTCCCGCTGTTCACCCACCGCTCAGGTGCC
TCT
CGGCGCTTGGAGAAGAAGACGGTCACCGTGGAGTTTTTCCTGGTGGGACAAGACAACGGGCCGGTGG
AG
GTGTCCACATTGCAGTGCTTAGCGAATGCCACAGACGGCGTGCGGCTAGCAGCCCGCATCGTGGACAC
A
CCCTGCAATGAGATGAACACCGACACCTTCCTCGAGGAGATTAACAAAGTTGGAAAGGAGCTGGGGATC
ATC
CCAACCATCATCCGGGATGAGGAACTGAAGACGAGAGGATTTGGAGGAATCTATGGGGTTGGCAAAG
CC
GCCCTGCATCCCCCAGCCCTGGCCGTCCTCAGCCACACCCCAGATGGAGCCACGCAGACCATCGCCTG
G
GTGGGCAAAGGCATCGTCTATGACACTGGAGGCCTCAGCATCAAAGGGAAGACTACCATGCCGGGGATG
AAG
CGAGACTGCGGGGGTGCTGCGGCCGTCCTGGGGGCCTTCAGAGCCGCAATCAAGCAGGGTTTCAAAG
AC
AACCTCCACGCTGTGTTCTGCTTGGCTGAGAACTCGGTGGGGCCCAATGCGACAAGGCCAGATGACAT
C
CACCTGCTGTACTCAGGGAAGACGGTGGAAATCAACAACACGGATGCCGAGGGCAGGCTGGTGCTGGCA
GAT
GGCGTGTCCTATGCTTGCAAGGACCTGGGGGCCGACATCATCCTGGACATGGCCACCCTGACCGGGG
CT
CAGGGCATTGCCACAGGGAAGTACCACGCCGCGGTGCTCACCAACAGCGCTGAGTGGGAGGCCGCCTG
T
GTGAAGGCGGGCAGGAAGTGTGGGGACCTGGTGCACCCGCTGGTCTACTGCCCCGAGCTGCACTTCAGC
GAG
TTCACCTCAGCTGTGGCGGACATGAAGAACTCAGTGGCGGACCGAGACAACAGCCCCAGCTCCTGTG
CT
GGCCTCTTCATCGCCTCACACATCGGCTTCGACTGGCCCGGAGTCTGGGTCCACCTGGACATTGCTGC
A
CCGGTGCATGCTGGTGAGCGAGCCACAGGCTTCGGTGTGGCCCTCCTGCTGGCGCTCTTCGGCCGTGCC
TCT
GAGGACCCTCTGCTGAACCTGGTGTCCCCACTGGGCTGTGAGGTGGATGTCGAGGAGGGGGACCTGG
GG
AGGGACTCCAAGAGACGCAGGCTTGTGTGA


Translation (523 aa):
MANVGLQFQASAGDSDPQSRPLLLLGQLHHLHRVPWSHVRGKLQPRVTEELWQAALSTLNPNPTDSCPLY
L
NYATVAALPCRVSRHNSPSAAHFITRLVRTCLPPGAHRCIV
MVCEQPEVFASACALARAFPLFTHRSGA
S
RRLEKKTVTVEFFLVGQDNGPVEVSTLQ
CLANATDGVRLAARIVDTPCNEMNTDTFLEEINKVGKELGI
I
PTIIRDEELKTRGFG
GIYGVGKAALHPPALAVLSHTPDGATQTIAWVGKGIVYDTGGLSIKGKTTMPGM
K
RDCGGAAAVLGAFRAAIKQ
GFKDNLHAVFCLAENSVGPNATRPDDIHLLYSGKTVEINNTDAEGRLVLA
D
GVSYACKDLGADIILDMATLTGAQ
GIATGKYHAAVLTNSAEWEAACVKAGRKCGDLVHPLVYCPELHFS
E
FTSAVADMKNSVA
DRDNSPSSCAGLFIASHIGFDWPGVWVHLDIAAPVHAGERATGFGVALLLALFGRA
S
EDPLLNLVSPLGCEVDVEEGDLGRDSKRRRLV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser