NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS46341.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
46341.1 Public Homo sapiens 2 DCTN1 22 109 92 CCDS HistoryNCBI Gene:1639Re-query CCDS DB by CCDS ID:46341.1Re-query CCDS DB by GeneID:1639See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 46341.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000409567.7 ENSP00000386843.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000409567.7Link to Ensembl Protein Viewer:ENSP00000386843.3Re-query CCDS DB by Nucleotide ID:ENST00000409567Re-query CCDS DB by Protein ID:ENSP00000386843
Original member NCBI NM_001135040.2 NP_001128512.1 Updated not alive Link to Nucleotide Sequence:NM_001135040.2Link to Protein Sequence:NP_001128512.1Re-query CCDS DB by Nucleotide ID:NM_001135040Re-query CCDS DB by Protein ID:NP_001128512
Current member NCBI NM_001135040.3 NP_001128512.1 Accepted alive Link to Nucleotide Sequence:NM_001135040.3Link to Protein Sequence:NP_001128512.1Re-query CCDS DB by Nucleotide ID:NM_001135040Re-query CCDS DB by Protein ID:NP_001128512Link to BLAST:NP_001128512.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001128512.1 1253 Q14203-4 1253 100% 0 0

Chromosomal Locations for CCDS 46341.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 2 (NC_000002.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 74361499 74361636 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 74362052 74362141 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 74362650 74362729 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 74362994 74363177 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 74363294 74363427 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 74365075 74365241 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 74365515 74365657 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 74365893 74366018 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 74366244 74366375 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 74366459 74366620 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 74366783 74366932 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 74367045 74367107 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 74367352 74367420 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 74367696 74367864 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 74367971 74368131 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 74368728 74368880 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 74369098 74369214 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 74369300 74369491 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 74369965 74370069 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 74370186 74370345 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 74370466 74370544 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 74370621 74370825 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 74370979 74371176 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 74371537 74371728 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 74377432 74377466 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 74377648 74377726 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 74378000 74378245 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 74380005 74380037 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3762 nt):
ATGGCACAGAGCAAGAGGCACGTGTACAGCCGGACGCCCAGCGGCAGCAGGATGAGTGCGGAGGCAAGCG
CC
CGGCCTCTGCGGGTGGGCTCCCGTGTAGAGGTGATTGGAAAAGGCCACCGAGGCACTGTGGCCTATGT
T
GGAGCCACACTGTTTGCCACTGGCAAATGGGTAGGCGTGATTCTGGATGAAGCAAAGGGCAAAAATGAT
GGA
ACTGTTCAAGGCAGGAAGTACTTCACTTGTGATGAAGGGCATGGCATCTTTGTGCGCCAGTCCCAGA
TC
CAGGTATTTGAAGATGGAGCAGATACTACTTCCCCAGAGACACCTGATTCTTCTGCTTCAAAAGTCCT
C
AAAAGAGAGGGAACTGATACAACTGCAAAGACTAGCAAACTGCCCACGCGCCCAGCCAGTACTGGGGTG
GCT
GGGGCCAGTAGCTCCCTGGGCCCCTCTGGCTCAGCGTCAGCAGGTGAGCTGAGCAGCAGTGAGCCCA
GC
ACCCCGGCTCAGACTCCGCTGGCAGCACCCATCATCCCCACGCCGGTCCTCACCTCTCCTGGAGCAGT
C
CCCCCGCTTCCTTCCCCATCCAAGGAGGAGGAGGGACTAAGGGCTCAGGTGCGGGACCTGGAGGAGAAA
CTA
GAGACCCTGAGACTGAAACGGGCAGAAGACAAAGCAAAGCTAAAAGAGCTGGAGAAACACAAAATCC
AG
CTGGAGCAGGTGCAGGAATGGAAGAGCAAAATGCAGGAGCAGCAGGCCGACCTGCAGCGGCGCCTCAA
G
GAGGCGAGAAAGGAAGCCAAGGAGGCGCTGGAGGCAAAGGAACGCTATATGGAGGAGATGGCTGATACT
GCT
GATGCCATTGAGATGGCCACTTTGGACAAGGAGATGGCTGAAGAGCGGGCTGAGTCCCTGCAGCAGG
AG
GTGGAGGCACTGAAGGAGCGGGTGGACGAGCTCACTACTGACTTAGAGATCCTCAAGGCTGAGATTGA
A
GAGAAGGGCTCAGATGGCGCTGCATCCAGTTATCAGCTCAAGCAGCTTGAGGAGCAGAATGCCCGCCTG
AAG
GATGCCCTGGTGAGGATGCGGGATCTTTCTTCCTCAGAGAAGCAGGAGCATGTGAAGCTCCAGAAGC
TC
ATGGAAAAGAAGAACCAAGAGCTGGAAGTTGTGAGGCAACAGCGGGAGCGTCTGCAGGAGGAGCTAAG
C
CAGGCAGAGAGCACCATTGATGAGCTCAAGGAGCAGGTGGATGCTGCTCTGGGTGCTGAGGAGATGGTG
GAG
ATGCTGACAGATCGGAACCTGAATCTGGAAGAGAAAGTGCGCGAGTTGAGGGAGACTGTGGGAGACT
TG
GAAGCGATGAATGAGATGAACGATGAGCTGCAGGAGAATGCACGTGAGACAGAACTGGAGCTGCGGGA
G
CAGCTGGACATGGCAGGCGCGCGGGTTCGTGAGGCCCAGAAGCGTGTGGAGGCAGCCCAGGAGACGGTT
GCA
GACTACCAGCAGACCATCAAGAAGTACCGCCAGCTGACCGCCCATCTACAGGATGTGAATCGGGAAC
TG
ACAAACCAGCAGGAAGCATCTGTGGAGAGGCAACAGCAGCCACCTCCAGAGACCTTTGACTTCAAAAT
C
AAGTTTGCTGAGACTAAGGCCCATGCCAAGGCAATTGAGATGGAATTGAGGCAGATGGAGGTGGCCCAG
GCC
AATCGACACATGTCCCTGCTGACAGCCTTCATGCCTGACAGCTTCCTTCGGCCAGGTGGGGACCATG
AC
TGCGTTCTGGTGCTGTTGCTCATGCCTCGTCTCATTTGCAAGGCAGAGCTGATCCGGAAGCAGGCCCA
G
GAGAAGTTTGAACTAAGTGAGAACTGTTCAGAGCGGCCTGGGCTGCGAGGAGCTGCTGGGGAGCAACTC
AGC
TTTGCTGCTGGACTGGTGTACTCGCTGAGCCTGCTGCAGGCCACGCTACACCGCTATGAGCATGCCC
TC
TCTCAGTGCAGTGTGGATGTGTATAAGAAAGTGGGCAGCCTGTACCCTGAGATGAGTGCCCATGAGCG
C
TCCTTGGATTTCCTCATTGAACTGCTGCACAAGGATCAGCTGGATGAGACTGTCAATGTGGAGCCTCTC
ACC
AAGGCCATCAAGTACTATCAGCATCTGTACAGCATCCACCTTGCCGAACAGCCTGAGGACTGTACTA
TG
CAGCTGGCTGACCACATTAAGTTCACGCAGAGTGCTCTGGACTGCATGAGTGTGGAGGTAGGACGGCT
G
CGTGCCTTCTTGCAGGGTGGGCAGGAGGCTACAGATATTGCCCTCCTGCTCCGGGATCTGGAAACTTCA
TGC
AGTGACATCCGCCAGTTCTGCAAGAAGATCCGAAGGCGAATGCCAGGGACAGATGCTCCTGGGATCC
CA
GCTGCACTGGCCTTTGGACCACAGGTATCTGACACGCTCCTAGACTGCAGGAAACACTTGACGTGGGT
C
GTGGCTGTGCTGCAGGAGGTGGCAGCTGCTGCTGCCCAGCTCATTGCCCCACTGGCAGAGAATGAGGGG
CTA
CTTGTGGCTGCTCTGGAGGAACTGGCTTTCAAAGCAAGCGAGCAGATCTATGGGACCCCCTCCAGCA
GC
CCCTATGAGTGTCTGCGCCAGTCATGCAACATCCTCATCAGTACCATGAACAAGCTGGCCACAGCCAT
G
CAGGAGGGGGAGTATGATGCAGAGCGGCCCCCCAGCAAGCCTCCACCGGTTGAACTGCGGGCTGCTGCC
CTT
CGTGCAGAGATCACAGATGCTGAAGGCCTGGGTTTGAAGCTCGAAGATCGAGAGACAGTTATTAAGG
AG
TTGAAGAAGTCACTCAAGATTAAGGGAGAGGAGCTAAGTGAGGCCAATGTGCGGCTGAGCCTCCTGGA
G
AAGAAGTTGGACAGTGCTGCCAAGGATGCAGATGAGCGCATCGAGAAAGTCCAGACTCGGCTGGAGGAG
ACC
CAGGCACTGCTGCGAAAGAAGGAGAAAGAGTTTGAGGAGACAATGGATGCACTCCAGGCTGACATCG
AC
CAGCTGGAGGCAGAGAAGGCAGAACTAAAGCAGCGTCTGAACAGCCAGTCCAAACGCACGATTGAGGG
A
CTCCGGGGCCCTCCTCCTTCAGGCATTGCTACTCTGGTCTCTGGCATTGCTGGTGGAGCCATCCCTGGG
CAG
GCTCCAGGGTCTGTGCCAGGCCCAGGGCTGGTGAAGGACTCACCACTGCTGCTTCAGCAGATCTCTG
CC
ATGAGGCTGCACATCTCCCAGCTCCAGCATGAGAACAGCATCCTCAAGGGAGCCCAGATGAAGGCATC
C
TTGGCATCCCTGCCCCCTCTGCATGTTGCAAAGCTATCCCATGAGGGCCCTGGCAGTGAGTTACCAGCT
GGA
GCGCTGTATCGTAAGACCAGCCAGCTGCTGGAGACATTGAATCAATTGAGCACACACACGCACGTAG
TA
GACATCACTCGCACCAGCCCTGCTGCCAAGAGCCCGTCGGCCCAACTTATGGAGCAAGTGGCTCAGCT
T
AAGTCCCTGAGTGACACCGTCGAGAAGCTCAAGGATGAGGTCCTCAAGGAGACAGTATCTCAGCGCCCT
GGA
GCCACAGTACCCACTGACTTTGCCACCTTCCCTTCATCAGCCTTCCTCAGGGCCAAGGAGGAGCAGC
AG
GATGACACAGTCTACATGGGCAAAGTGACCTTCTCATGTGCGGCTGGTTTTGGACAGCGACACCGGCT
G
GTGCTGACCCAGGAGCAGCTGCACCAGCTTCACAGTCGCCTCATCTCCTAA


Translation (1253 aa):
MAQSKRHVYSRTPSGSRMSAEASARPLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKND
G
TVQGRKYFTCDEGHGIFVRQSQ
IQVFEDGADTTSPETPDSSASKVLKREGTDTTAKTSKLPTRPASTGV
A
GASSSLGPSGSASAGELSSSEPSTPAQTPLAAPIIPTPVLTSPGAVPPLPSPSK
EEEGLRAQVRDLEEK
L
ETLRLKRAEDKAKLKELEKHKIQLEQVQEWKSKMQEQQADLQRRLKEARK
EAKEALEAKERYMEEMADT
A
DAIEMATLDKEMAEERAESLQQEVEALKERVDELTTDLEILKAEIEEK
GSDGAASSYQLKQLEEQNARL
K
DALV
RMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQEELSQAESTIDELKEQVDAALGAEEMV
E
MLTDRNLNLEEKVRELRETVGDL
EAMNEMNDELQENARETELELREQLDMAGARVREAQKRVEAAQETV
A
DYQQTIKKYRQLTAHLQ
DVNRELTNQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQ
A
NRHMSLLTAFMPDSFLRPGGDHDCVLVLLLMPRLICK
AELIRKQAQEKFELSENCSERPGLRGAAGEQL
S
FAAGLVYSLSLLQATLHRYE
HALSQCSVDVYKKVGSLYPEMSAHERSLDFLIELLHKDQLDETVNVEPL
T
KAIKYYQ
HLYSIHLAEQPEDCTMQLADHIKFTQSALDCMSVEVGRLRAFLQGGQEATDIALLLRDLETS
C
SDIRQFCKKIRRRMPGTDAPGIPAALAFGPQ
VSDTLLDCRKHLTWVVAVLQEVAAAAAQLIAPLAENEG
L
LVAALEELAFKASEQ
IYGTPSSSPYECLRQSCNILISTMNKLATAMQEGEYDAERPPSKPPPVELRAAA
L
RAEITDAEGLGLKLEDRETVIKELKKSLKIK
GEELSEANVRLSLLEKKLDSAAKDADERIEKVQTRLEE
T
QALLRKKE
KEFEETMDALQADIDQLEAEKAELKQRLNSQSKRTIEGLRGPPPSGIATLVSGIAGGAIPG
Q
APGSVPGPGLVKDSPLLLQQISAMRLHISQLQHENSILK
GAQMKASLASLPPLHVAKLSHEGPGSELPA
G
ALYRKTSQLLETLNQLSTHTHVVDITRTSP
AAKSPSAQLMEQVAQLKSLSDTVEKLKDEVLKETVSQRP
G
ATVPTDFATFPSSAFLR
AKEEQQDDTVYMGKVTFSCAAGFGQRHRLVLTQEQLHQLHSRLIS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser