NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS46221.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
46221.1 Public Homo sapiens 2 PXDN 24 110 108 CCDS HistoryNCBI Gene:7837Re-query CCDS DB by CCDS ID:46221.1Re-query CCDS DB by GeneID:7837See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 46221.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000252804.9 ENSP00000252804.4 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000252804.9Link to Ensembl Protein Viewer:ENSP00000252804.4Re-query CCDS DB by Nucleotide ID:ENST00000252804Re-query CCDS DB by Protein ID:ENSP00000252804
Original member Current member NCBI NM_012293.3 NP_036425.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_012293.3Link to Protein Sequence:NP_036425.1Re-query CCDS DB by Nucleotide ID:NM_012293Re-query CCDS DB by Protein ID:NP_036425Link to BLAST:NP_036425.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_036425.1 1479 Q92626-1 1479 100% 0 0

Chromosomal Locations for CCDS 46221.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 2 (NC_000002.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 1634204 1634323 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 1635408 1635521 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 1638846 1638978 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 1639302 1639422 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 1643368 1643576 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 1644618 1644752 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 1648172 1649675 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 1653628 1653785 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 1654400 1654508 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 1660881 1661037 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 1662072 1662184 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 1663605 1663763 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 1664958 1665074 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 1666214 1666486 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 1673643 1673812 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 1676927 1677044 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 1680193 1680362 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 1683656 1683727 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 1684080 1684151 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 1687632 1687703 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 1691928 1691999 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 1693063 1693134 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 1744256 1744455 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4440 nt):
ATGGCCAAGCGCTCCAGGGGCCCCGGGCGCCGCTGCCTGTTGGCGCTCGTGCTGTTCTGCGCCTGGGGGA
CG
CTGGCCGTGGTGGCCCAGAAGCCGGGCGCAGGGTGTCCGAGCCGCTGCCTGTGCTTCCGCACCACCGT
G
CGCTGCATGCATCTGCTGCTGGAGGCCGTGCCCGCCGTGGCGCCGCAGACCTCCATCCTAGATCTTCGC
TTT
AACAGAATCAGAGAGATCCAACCTGGGGCATTCAGGCGGCTGAGGAACTTGAACACATTGCTTCTCA
AT
AATAATCAGATCAAGAGGATACCTAGTGGAGCATTTGAAGACTTGGAAAATTTAAAATATCTCTATCT
G
TACAAGAATGAGATCCAGTCAATTGACAGGCAAGCATTTAAGGGACTTGCCTCTCTAGAGCAACTATAC
CTG
CACTTTAATCAGATAGAAACTTTGGACCCAGATTCGTTCCAGCATCTCCCGAAGCTCGAGAGGCTAT
TT
TTGCATAACAACCGGATTACACATTTAGTTCCAGGGACATTTAATCACTTGGAATCTATGAAGAGATT
G
CGACTGGACTCAAACACACTTCACTGCGACTGTGAAATCCTGTGGTTGGCGGATTTGCTGAAAACCTAC
GCG
GAGTCGGGGAACGCGCAGGCAGCGGCCATCTGTGAATATCCCAGACGCATCCAGGGACGCTCAGTGG
CA
ACCATCACCCCGGAAGAGCTGAACTGTGAAAGGCCCCGGATCACCTCCGAGCCCCAGGACGCAGATGT
G
ACCTCGGGGAACACCGTGTACTTCACCTGCAGAGCCGAAGGCAACCCCAAGCCTGAGATCATCTGGCTG
CGA
AACAATAATGAGCTGAGCATGAAGACAGATTCCCGCCTAAACTTGCTGGACGATGGGACCCTGATGA
TC
CAGAACACACAGGAGACAGACCAGGGTATCTACCAGTGCATGGCAAAGAACGTGGCCGGAGAGGTGAA
G
ACGCAAGAGGTGACCCTCAGGTACTTCGGGTCTCCAGCTCGACCCACTTTTGTAATCCAGCCACAGAAT
ACA
GAGGTGCTGGTTGGGGAGAGCGTCACGCTGGAGTGCAGCGCCACAGGCCACCCCCCGCCGCGGATCT
CC
TGGACGAGAGGTGACCGCACACCCTTGCCAGTTGACCCGCGGGTGAACATCACGCCTTCTGGCGGGCT
T
TACATACAGAACGTCGTACAGGGGGACAGCGGAGAGTATGCGTGCTCTGCGACCAACAACATTGACAGC
GTC
CATGCCACCGCTTTCATCATCGTCCAGGCTCTTCCTCAGTTCACTGTGACGCCTCAGGACAGAGTCG
TT
ATTGAGGGCCAGACCGTGGATTTCCAGTGTGAAGCCAAGGGCAACCCGCCGCCCGTCATCGCCTGGAC
C
AAGGGAGGGAGCCAGCTCTCCGTGGACCGGCGGCACCTGGTCCTGTCATCGGGAACACTTAGAATCTCT
GGT
GTTGCCCTCCACGACCAGGGCCAGTACGAATGCCAGGCTGTCAACATCATCGGCTCCCAGAAGGTCG
TG
GCCCACCTGACTGTGCAGCCCAGAGTCACCCCAGTGTTTGCCAGCATTCCCAGCGACACAACAGTGGA
G
GTGGGCGCCAATGTGCAGCTCCCGTGCAGCTCCCAGGGCGAGCCCGAGCCAGCCATCACCTGGAACAAG
GAT
GGGGTTCAGGTGACAGAAAGTGGAAAATTTCACATCAGCCCTGAAGGATTCTTGACCATCAATGACG
TT
GGCCCTGCAGACGCAGGTCGCTATGAGTGTGTGGCCCGGAACACCATTGGGTCGGCCTCGGTGAGCAT
G
GTGCTCAGTGTGAATGTTCCTGACGTCAGTCGAAATGGAGATCCGTTTGTAGCTACCTCCATCGTGGAA
GCG
ATTGCGACTGTTGACAGAGCTATAAACTCAACCCGAACACATTTGTTTGACAGCCGTCCTCGTTCTC
CA
AATGATTTGCTGGCCTTGTTCCGGTATCCGAGGGATCCTTACACAGTTGAACAGGCACGGGCGGGAGA
A
ATCTTTGAACGGACATTGCAGCTCATTCAGGAGCATGTACAGCATGGCTTGATGGTCGACCTCAACGGA
ACA
AGTTACCACTACAACGACCTGGTGTCTCCACAGTACCTGAACCTCATCGCAAACCTGTCGGGCTGTA
CC
GCCCACCGGCGCGTGAACAACTGCTCGGACATGTGCTTCCACCAGAAGTACCGGACGCACGACGGCAC
C
TGTAACAACCTGCAGCACCCCATGTGGGGCGCCTCGCTGACCGCCTTCGAGCGCCTGCTGAAATCCGTG
TAC
GAGAATGGCTTCAACACCCCTCGGGGCATCAACCCCCACCGACTGTACAACGGGCACGCCCTTCCCA
TG
CCGCGCCTGGTGTCCACCACCCTGATCGGGACGGAGACCGTCACACCCGACGAGCAGTTCACCCACAT
G
CTGATGCAGTGGGGCCAGTTCCTGGACCACGACCTCGACTCCACGGTGGTGGCCCTGAGCCAGGCACGC
TTC
TCCGACGGACAGCACTGCAGCAACGTGTGCAGCAACGACCCCCCCTGCTTCTCTGTCATGATCCCCC
CC
AATGACTCCCGGGCCAGGAGCGGGGCCCGCTGCATGTTCTTCGTGCGCTCCAGCCCTGTGTGCGGCAG
C
GGCATGACTTCGCTGCTCATGAACTCCGTGTACCCGCGGGAGCAGATCAACCAGCTCACCTCCTACATA
GAC
GCATCCAACGTGTACGGGAGCACGGAGCATGAGGCCCGCAGCATCCGCGACCTGGCCAGCCACCGCG
GC
CTGCTGCGGCAGGGCATCGTGCAGCGGTCCGGGAAGCCGCTGCTCCCCTTCGCCACCGGGCCGCCCAC
G
GAGTGCATGCGGGACGAGAACGAGAGCCCCATCCCCTGCTTCCTGGCCGGGGACCACCGCGCCAACGAG
CAG
CTGGGCCTGACCAGCATGCACACGCTGTGGTTCCGCGAGCACAACCGCATTGCCACGGAGCTGCTCA
AG
CTGAACCCGCACTGGGACGGCGACACCATCTACTATGAGACCAGGAAGATCGTGGGTGCGGAGATCCA
G
CACATCACCTACCAGCACTGGCTCCCGAAGATCCTGGGGGAGGTGGGCATGAGGACGCTGGGAGAGTAC
CAC
GGCTACGACCCCGGCATCAATGCTGGCATCTTCAACGCCTTCGCCACCGCGGCCTTCAGGTTTGGCC
AC
ACGCTTGTCAACCCACTGCTTTACCGGCTGGACGAGAACTTCCAGCCCATTGCACAAGATCACCTCCC
C
CTTCACAAAGCTTTCTTCTCTCCCTTCCGGATTGTGAATGAGGGCGGCATCGATCCGCTTCTCAGGGGG
CTG
TTCGGGGTGGCGGGGAAAATGCGTGTGCCCTCGCAGCTGCTGAACACGGAGCTCACGGAGCGGCTGT
TC
TCCATGGCACACACGGTGGCTCTGGACCTGGCGGCCATCAACATCCAGCGGGGCCGGGACCACGGGAT
C
CCACCCTACCACGACTACAGGGTCTACTGCAATCTATCGGCGGCACACACGTTCGAGGACCTGAAAAAT
GAG
ATTAAAAACCCTGAGATCCGGGAGAAACTGAAAAGGTTGTATGGCTCGACACTCAACATCGACCTGT
TT
CCGGCGCTCGTGGTGGAGGACCTGGTGCCTGGCAGCCGGCTGGGCCCCACCCTGATGTGTCTTCTCAG
C
ACACAGTTCAAGCGCCTGCGAGATGGGGACAGGTTGTGGTATGAGAACCCTGGGGTGTTCTCCCCGGCC
CAG
CTGACTCAGATCAAGCAGACGTCGCTGGCCAGGATCCTATGCGACAACGCGGACAACATCACCCGGG
TG
CAGAGCGACGTGTTCAGGGTGGCGGAGTTCCCTCACGGCTACGGCAGCTGTGACGAGATCCCCAGGGT
A
GACCTCCGGGTGTGGCAGGACTGCTGTGAAGACTGTAGGACCAGGGGGCAGTTCAATGCCTTTTCCTAT
CAT
TTCCGAGGCAGACGGTCTCTTGAGTTCAGCTACCAGGAGGACAAGCCGACCAAGAAAACAAGACCAC
GG
AAAATACCCAGTGTTGGGAGACAGGGGGAACATCTCAGCAACAGCACCTCAGCCTTCAGCACACGCTC
A
GATGCATCTGGGACAAATGACTTCAGAGAGTTTGTTCTGGAAATGCAGAAGACCATCACAGACCTCAGA
ACA
CAGATAAAGAAACTTGAATCACGGCTCAGTACCACAGAGTGCGTGGATGCCGGGGGCGAATCTCACG
CC
AACAACACCAAGTGGAAAAAAGATGCATGCACCATTTGTGAATGCAAAGACGGGCAGGTCACCTGCTT
C
GTGGAAGCTTGCCCCCCTGCCACCTGTGCTGTCCCCGTGAACATCCCAGGGGCCTGCTGTCCAGTCTGC
TTA
CAGAAGAGGGCGGAGGAAAAGCCCTAG


Translation (1479 aa):
MAKRSRGPGRRCLLALVLFCAWGTLAVVAQKPGAGCPSRCLCFRTTVRCMHLLLEAVPAVAPQTSILDLR
F
NRIREIQPGAFRRLRNLNT
LLLNNNQIKRIPSGAFEDLENLKYLYLYKNEIQSIDRQAFKGLASLEQLY
L
HFNQIETLDPDSFQHLPKLER
LFLHNNRITHLVPGTFNHLESMKRLRLDSNTLHCDCEILWLADLLKTY
A
ESGNAQAAAICEYPRRIQGRSVATITPEELNC
ERPRITSEPQDADVTSGNTVYFTCRAEGNPKPEIIWL
R
N
NNELSMKTDSRLNLLDDGTLMIQNTQETDQGIYQCMAKNVAGEVKTQEVTLRYFGSPARPTFVIQPQN
T
EVLVGESVTLECSATGHPPPRISWTRGDRTPLPVDPRVNITPSGGLYIQNVVQGDSGEYACSATNNIDS
V
HATAFIIVQ
ALPQFTVTPQDRVVIEGQTVDFQCEAKGNPPPVIAWTKGGSQLSVDRRHLVLSSGTLRIS
G
VALHDQGQYECQAVNIIGSQKVVAHLTVQPR
VTPVFASIPSDTTVEVGANVQLPCSSQGEPEPAITWNK
D
GVQVTESGKFHISPEGFLTINDVGPADAGRYECVARNTIGSASVSMVLSVN
VPDVSRNGDPFVATSIVE
A
IATVDRAINSTRTHLFD
SRPRSPNDLLALFRYPRDPYTVEQARAGEIFERTLQLIQEHVQHGLMVDLNG
T
SYHYNDLVSPQYLNLIANLSGCTAHRRVNNCSDMCFHQKYRTHDGTCNNLQHPMWGASLTAFERLLKSV
Y
ENGFNTPRGINPHRLYNGHALPMPRLVSTTLIGTETVTPDEQFTHMLMQWGQFLDHDLDSTVVALSQAR
F
SDGQHCSNVCSNDPPCFSVMIPPNDSRARSGARCMFFVRSSPVCGSGMTSLLMNSVYPREQINQLTSYI
D
ASNVYGSTEHEARSIRDLASHRGLLRQGIVQRSGKPLLPFATGPPTECMRDENESPIPCFLAGDHRANE
Q
LGLTSMHTLWFREHNRIATELLKLNPHWDGDTIYYETRKIVGAEIQHITYQHWLPKILGEVGMRTLGEY
H
GYDPGINAGIFNAFATAAFRFGHTLVNPLLYRLDENFQPIAQDHLPLHKAFFSPFRIVNEGGIDPLLRG
L
FGVAGKMRVPSQLLNTELTERLFSMAHTVALDLAAINIQRGRDHGIPPYHDYRVYCNLSAAHTFEDLKN
E
IKNPEIREKLK
RLYGSTLNIDLFPALVVEDLVPGSRLGPTLMCLLSTQFKRLRDGDRLWYENPGVFSPA
Q
LTQIKQTSLARILCDNADNITRVQSDVFRVAEFPHGYGSCDEIPRVDLRVWQDCCE
DCRTRGQFNAFSY
H
FRGRRSLEFSYQEDKPTKKTRPRKIP
SVGRQGEHLSNSTSAFSTRSDASGTNDFREFVLEMQKTITDLR
T
Q
IKKLESRLSTTECVDAGGESHANNTKWKKDACTICECKDGQVTCFVEACPPATCAVPVNIPGACCPVC
L
QKRAEEKP




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser