NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS46113.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
46113.1 Public Homo sapiens 19 FOSB 22 109 92 CCDS HistoryNCBI Gene:2354Re-query CCDS DB by CCDS ID:46113.1Re-query CCDS DB by GeneID:2354See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 46113.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000417353.6 ENSP00000407207.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000417353.6Link to Ensembl Protein Viewer:ENSP00000407207.1Re-query CCDS DB by Nucleotide ID:ENST00000417353Re-query CCDS DB by Protein ID:ENSP00000407207
Original member NCBI NM_001114171.1 NP_001107643.1 Updated not alive Link to Nucleotide Sequence:NM_001114171.1Link to Protein Sequence:NP_001107643.1Re-query CCDS DB by Nucleotide ID:NM_001114171Re-query CCDS DB by Protein ID:NP_001107643
Current member NCBI NM_001114171.2 NP_001107643.1 Accepted alive Link to Nucleotide Sequence:NM_001114171.2Link to Protein Sequence:NP_001107643.1Re-query CCDS DB by Nucleotide ID:NM_001114171Re-query CCDS DB by Protein ID:NP_001107643Link to BLAST:NP_001107643.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001107643.1 302 P53539-2 302 100% 0 0

Chromosomal Locations for CCDS 46113.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 19 (NC_000019.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 45468587 45468712 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 45470629 45470949 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 45472551 45473012 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (909 nt):
ATGTTTCAGGCTTTCCCCGGAGACTACGACTCCGGCTCCCGGTGCAGCTCCTCACCCTCTGCCGAGTCTC
AA
TATCTGTCTTCGGTGGACTCCTTCGGCAGTCCACCCACCGCCGCCGCCTCCCAGGAGTGCGCCGGTCT
C
GGGGAAATGCCCGGTTCCTTCGTGCCCACGGTCACCGCGATCACAACCAGCCAGGACCTCCAGTGGCTT
GTG
CAACCCACCCTCATCTCTTCCATGGCCCAGTCCCAGGGGCAGCCACTGGCCTCCCAGCCCCCGGTCG
TC
GACCCCTACGACATGCCGGGAACCAGCTACTCCACACCAGGCATGAGTGGCTACAGCAGTGGCGGAGC
G
AGTGGCAGTGGTGGGCCTTCCACCAGCGGAACTACCAGTGGGCCTGGGCCTGCCCGCCCAGCCCGAGCC
CGG
CCTAGGAGACCCCGAGAGGAGACGGAGACAGATCAGTTGGAGGAAGAAAAAGCAGAGCTGGAGTCGG
AG
ATCGCCGAGCTCCAAAAGGAGAAGGAACGTCTGGAGTTTGTGCTGGTGGCCCACAAACCGGGCTGCAA
G
ATCCCCTACGAAGAGGGGCCCGGGCCGGGCCCGCTGGCGGAGGTGAGAGATTTGCCGGGCTCAGCACCG
GCT
AAGGAAGATGGCTTCAGCTGGCTGCTGCCGCCCCCGCCACCACCGCCCCTGCCCTTCCAGACCAGCC
AA
GACGCACCCCCCAACCTGACGGCTTCTCTCTTTACACACAGTGAAGTTCAAGTCCTCGGCGACCCCTT
C
CCCGTTGTTAACCCTTCGTACACTTCTTCGTTTGTCCTCACCTGCCCGGAGGTCTCCGCGTTCGCCGGC
GCC
CAACGCACCAGCGGCAGTGACCAGCCTTCCGATCCCCTGAACTCGCCCTCCCTCCTCGCTCTGTGA


Translation (302 aa):
MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTAITTSQDLQWL
V
QPTLISSMAQSQGQPLASQPPVVDPYDMPGTSYSTPGMSGYSSGGASGSGGPSTSGTTSGPGPARPARA
R
PRRPREET
ETDQLEEEKAELESEIAELQKEKERLEFVLVAHKPGCKIPYEEGPGPGPLAEVRDLPGSAP
A
KEDGFSWLLPPPPPPPLPFQTSQDAPPNLTASLFTHSEVQVLGDPFPVVNPSYTSSFVLTCPEVSAFAG
A
QRTSGSDQPSDPLNSPSLLAL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser