NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, June 25, 2024, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS45644.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
45644.1 Public Homo sapiens 17 GOSR1 24 110 108 CCDS HistoryNCBI Gene:9527Re-query CCDS DB by CCDS ID:45644.1Re-query CCDS DB by GeneID:9527See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 45644.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000467337.6 ENSP00000462638.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000467337.6Link to Ensembl Protein Viewer:ENSP00000462638.1Re-query CCDS DB by Nucleotide ID:ENST00000467337Re-query CCDS DB by Protein ID:ENSP00000462638
Original member Current member NCBI NM_001007024.2 NP_001007025.1 Accepted alive Link to Nucleotide Sequence:NM_001007024.2Link to Protein Sequence:NP_001007025.1Re-query CCDS DB by Nucleotide ID:NM_001007024Re-query CCDS DB by Protein ID:NP_001007025Link to BLAST:NP_001007025.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001007025.1 185 O95249-2 185 100% 0 0

Chromosomal Locations for CCDS 45644.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 17 (NC_000017.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 30484257 30484301 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 30484663 30484770 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 30490126 30490217 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 30492679 30492753 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 30510880 30510909 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 30519939 30520021 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 30522254 30522378 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (558 nt):
ATGTTTGAGACAATGGCGATTGAGATTGAACAACTTTTGGCAAGGCTTACAGGGGTAAATGATAAAATGG
CA
GAATATACCAACAGTGCAGGTGTCCCCTCCTTGAATGCAGCCCTGATGCATACATTACAGCGGCATAG
A
GACATATTGCAGGATTATACACATGAATTCCATAAAACCAAAGCAAACTTTATGGCAATACGGGAAAGG
GAG
AATCTTATGGGATCAGTACGAAAAGATATTGAGTCATATAAAAGTGGGTCTGGAGTAAACAACAGAA
GA
ACTGAGCTATTTTTGAAAGAACATGACCACCTTCGAAACTCAGATCGTCTGATAGAAGAGACAATAAG
C
ATTGCTATGGCAACAAAAGAAAATATGACTTCACAGAGAGGAATGTTGAAGTCAATTCACAGCAAAATG
AAC
ACTTTGGCCAATCGTTTTCCTGCTGTAAACAGCCTGATCCAGAGGATCAACCTGAGGAAGCGGCGGG
AC
TCGCTCATCCTAGGGGGTGTTATTGGGATCTGTACCATCCTGTTGCTGCTGTATGCGTTCCATTGA


Translation (185 aa):
MFETMAIEIEQLLARLTGVNDKMAEYTNSAGVPSLNAALMHTLQRHRDILQDYTHEFHKTKANFMAIRER
E
NLMGSVRKDI
ESYKSGSGVNNRRTELFLKEHDHLRNSDRLIEETISIAMATKENMTSQRGMLKSIHSKM
N
TLA
NRFPAVNSLIQRINLRKRRDSLILGGVIGICTILLLLYAFH



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser