NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, June 25, 2024, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS45350.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
45350.1 Public Homo sapiens 15 FES 24 110 108 CCDS HistoryNCBI Gene:2242Re-query CCDS DB by CCDS ID:45350.1Re-query CCDS DB by GeneID:2242See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 45350.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000394300.7 ENSP00000377837.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000394300.7Link to Ensembl Protein Viewer:ENSP00000377837.3Re-query CCDS DB by Nucleotide ID:ENST00000394300Re-query CCDS DB by Protein ID:ENSP00000377837
Original member Current member NCBI NM_001143783.1 NP_001137255.1 Accepted alive Link to Nucleotide Sequence:NM_001143783.1Link to Protein Sequence:NP_001137255.1Re-query CCDS DB by Nucleotide ID:NM_001143783Re-query CCDS DB by Protein ID:NP_001137255Link to BLAST:NP_001137255.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001137255.1 764 P07332-3 764 100% 0 0

Chromosomal Locations for CCDS 45350.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 15 (NC_000015.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 90885046 90885258 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90886961 90887057 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90887187 90887370 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90889306 90889443 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90889517 90889636 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90889840 90889962 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90890092 90890278 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90890401 90890484 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90890982 90891191 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90891554 90891676 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90892058 90892111 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90892707 90892825 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90893100 90893194 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90893291 90893414 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90893654 90893811 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90893936 90894058 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 90895416 90895558 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2295 nt):
ATGGGCTTCTCTTCCGAGCTGTGCAGCCCCCAGGGCCACGGGGTCCTGCAGCAAATGCAGGAGGCCGAGC
TT
CGTCTACTGGAGGGCATGAGAAAGTGGATGGCCCAGCGGGTCAAGAGTGACAGGGAGTATGCAGGACT
G
CTTCACCACATGTCCCTGCAGGACAGTGGGGGCCAGAGCCGGGCCATCAGCCCTGACAGCCCCATCAGT
CAG
ACCCACAGCCAGGACATTGAGAAGCTGAAGAGCCAGTACCGAGCTCTGGCACGGGACAGTGCCCAAG
CC
AAGCGCAAGTACCAGGAGGCCAGCAAAGACAAGGACCGTGACAAGGCTAAGGACAAGTATGTGCGCAG
C
CTGTGGAAGCTCTTTGCTCACCACAACCGCTATGTGCTGGGCGTGCGGGCTGCGCAGCTACACCACCAG
CAC
CACCACCAGCTCCTGCTGCCCGGCCTGCTGCGGTCACTGCAGGACCTGCACGAGGAGATGGCTTGCA
TC
CTGAAGGAGATCCTGCAGGAATACCTGGAGATTAGCAGCCTGGTGCAGGATGAGGTGGTGGCCATTCA
C
CGGGAGATGGCTGCAGCTGCTGCCCGCATCCAGCCTGAGGCTGAGTACCAAGGCTTCCTGCGACAGTAT
GG
G
TCCGCACCTGACGTCCCACCCTGTGTCACGTTCGATGAGTCACTGCTTGAGGAGGGTGAACCGCTGG
AG
CCTGGGGAGCTCCAGCTGAACGAGCTGACTGTGGAGAGCGTGCAGCACACGCTGACCTCAGTGACAGA
T
GAGCTGGCTGTGGCCACCGAGATGGTGTTCAGGCGGCAGGAGATGGTTACGCAGCTGCAACAGGAGCTC
CGG
AATGAAGAGGAGAACACCCACCCCCGGGAGCGGGTGCAGCTGCTGGGCAAGAGGCAAGTGCTGCAAG
AA
GCACTGCAGGGGCTGCAGGTAGCGCTGTGCAGCCAGGCCAAGCTGCAGGCCCAGCAGGAGTTGCTGCA
G
ACCAAGCTGGAGCACCTGGGCCCCGGCGAGCCCCCGCCTGTGCTGCTCCTGCAGGATGACCGCCACTCC
ACG
TCGTCCTCGGAGCAGGAGCGAGAGGGGGGAAGGACACCCACGCTGGAGATCCTTAAGAGCCACATCT
CA
GGAATCTTCCGCCCCAAGTTCTCGCTCCCTCCACCGCTGCAGCTCATTCCGGAGGTGCAGAAGCCCCT
G
CATGAGCAGCTGTGGTACCACGGGGCCATCCCGAGGGCAGAGGTGGCTGAGCTGCTGGTGCACTCTGGG
GAC
TTCCTGGTGCGGGAGAGCCAGGGCAAGCAGGAGTACGTGCTGTCGGTGCTGTGGGATGGTCTGCCCC
GG
CACTTCATCATCCAGTCCTTGGATAACCTGTACCGACTGGAAGGGGAAGGCTTTCCTAGCATTCCTTT
G
CTCATCGACCACCTACTGAGCACCCAGCAGCCCCTCACCAAGAAGAGTGGTGTTGTCCTGCACAGGGCT
GTG
CCCAAGGACAAGTGGGTGCTGAACCATGAGGACCTGGTGTTGGGTGAGCAGATTGGACGGGGGAACT
TT
GGCGAAGTGTTCAGCGGACGCCTGCGAGCCGACAACACCCTGGTGGCGGTGAAGTCTTGTCGAGAGAC
G
CTCCCACCTGACCTCAAGGCCAAGTTTCTACAGGAAGCGAGGATCCTGAAGCAGTACAGCCACCCCAAC
ATC
GTGCGTCTCATTGGTGTCTGCACCCAGAAGCAGCCCATCTACATCGTCATGGAGCTTGTGCAGGGGG
GC
GACTTCCTGACCTTCCTCCGCACGGAGGGGGCCCGCCTGCGGGTGAAGACTCTGCTGCAGATGGTGGG
G
GATGCAGCTGCTGGCATGGAGTACCTGGAGAGCAAGTGCTGCATCCACCGGGACCTGGCTGCTCGGAAC
TGC
CTGGTGACAGAGAAGAATGTCCTGAAGATCAGTGACTTTGGGATGTCCCGAGAGGAAGCCGATGGGG
TC
TATGCAGCCTCAGGGGGCCTCAGACAAGTCCCCGTGAAGTGGACCGCACCTGAGGCCCTTAACTACGG
C
CGCTACTCCTCCGAAAGCGACGTGTGGAGCTTTGGCATCTTGCTCTGGGAGACCTTCAGCCTGGGGGCC
TCC
CCCTATCCCAACCTCAGCAATCAGCAGACACGGGAGTTTGTGGAGAAGGGGGGCCGTCTGCCCTGCC
CA
GAGCTGTGTCCTGATGCCGTGTTCAGGCTCATGGAGCAGTGCTGGGCCTATGAGCCTGGGCAGCGGCC
C
AGCTTCAGCACCATCTACCAGGAGCTGCAGAGCATCCGAAAGCGGCATCGGTGA


Translation (764 aa):
MGFSSELCSPQGHGVLQQMQEAELRLLEGMRKWMAQRVKSDREYAGLLHHMSLQDSGGQSRAISPDSPIS
Q
THSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQ
H
HHQLLLPGLLRSLQDLHEEMACI
LKEILQEYLEISSLVQDEVVAIHREMAAAAARIQPEAEYQGFLRQY
G
SAPDVPPCVTFDESLLEEGEPLEPGELQLNELTVESVQHTLTSVTDELAVATEMVFRRQEMVTQLQQEL
R
NEEENTHPRE
RVQLLGKRQVLQEALQGLQVALCSQAKLQAQQELLQTKLEHLGPGEPPPVLLLQDDRHS
T
SSS
EQEREGGRTPTLEILKSHISGIFRPKFSLPPPLQLIPEVQKPLHEQLWYHGAIPRAEVAELLVHSG
D
FLVRESQGKQEYVLSVLWDGLPRHFIIQSLD
NLYRLEGEGFPSIPLLIDHLLSTQQPLTKKSGVVLHRA
V
PK
DKWVLNHEDLVLGEQIGRGNFGEVFSGRLRADNTLVAVKSCRETLPPDLKAKFLQEARILKQYSHPN
I
VRLIGVCTQKQPIYIVMELVQ
GGDFLTFLRTEGARLRVKTLLQMVGDAAAGMEYLESKCCIHRDLAARN
C
LVTEKNVLKISDFGMSREEADGVYAASGGLRQVPVKWTAPEALNY
GRYSSESDVWSFGILLWETFSLGA
S
PYPNLSNQQTREFVEK
GGRLPCPELCPDAVFRLMEQCWAYEPGQRPSFSTIYQELQSIRKRHR



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser