NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS4535.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
4535.1 Public Homo sapiens 6 DTNBP1 20 108 85 CCDS HistoryNCBI Gene:84062Re-query CCDS DB by CCDS ID:4535.1Re-query CCDS DB by GeneID:84062See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 4535.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000338950 ENSP00000344718 Accepted alive Link to Ensembl Transcript Viewer:ENST00000338950Link to Ensembl Protein Viewer:ENSP00000344718Re-query CCDS DB by Nucleotide ID:ENST00000338950Re-query CCDS DB by Protein ID:ENSP00000344718
Original member Current member EBI,WTSI OTTHUMT00000039934 OTTHUMP00000016063 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000039934Link to Vega Protein Viewer:OTTHUMP00000016063Re-query CCDS DB by Nucleotide ID:OTTHUMT00000039934Re-query CCDS DB by Protein ID:OTTHUMP00000016063
Original member Current member NCBI NM_183040.2 NP_898861.1 Accepted alive Link to Nucleotide Sequence:NM_183040.2Link to Protein Sequence:NP_898861.1Re-query CCDS DB by Nucleotide ID:NM_183040Re-query CCDS DB by Protein ID:NP_898861Link to BLink:NP_898861.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_898861.1 303 Q96EV8-2 303 100% 0 0

Chromosomal Locations for CCDS 4535.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 6 (NC_000006.12)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 6Link to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 15524425 15524669 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 15533240 15533395 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 15593059 15593081 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 15615267 15615399 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 15627343 15627475 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 15637744 15637804 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 15651313 15651363 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 15652087 15652140 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 15662814 15662869 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (912 nt):
ATGCTGGAGACCCTTCGCGAGCGGCTGCTGAGCGTGCAGCAGGATTTCACCTCCGGGCTGAAGACTTTAA
GT
GACAAGTCAAGAGAAGCAAAAGTGAAAAGCAAACCCAGGACTGTTCCATTTTTGCCAAAGTACTCTGC
T
GGATTAGAATTACTTAGCAGGTATGAGGATACATGGGCTGCACTTCACAGAAGAGCCAAAGACTGTGCA
AGT
GCTGGAGAGCTGGTGGATAGCGAGGTGGTCATGCTTTCTGCGCACTGGGAGAAGAAAAAGACAAGCC
TC
GTGGAGCTGCAAGAGCAGCTCCAGCAGCTCCCAGCTTTAATCGCAGACTTAGAATCCATGACAGCAAA
T
CTGACTCATTTAGAGGCGAGTTTTGAGGAGGTAGAGAACAACCTGCTGCATCTGGAAGACTTATGTGGG
CAG
TGTGAATTAGAAAGATGCAAACATATGCAGTCCCAGCAACTGGAGAATTACAAGAAAAATAAGAGGA
AG
GAACTTGAAACCTTCAAAGCTGAACTAGATGCAGAGCACGCCCAGAAGGTCCTGGAAATGGAGCACAC
C
CAGCAAATGAAGCTGAAGGAGCGGCAGAAGTTTTTTGAGGAAGCCTTCCAGCAGGACATGGAGCAGTAC
CTG
TCCACTGGCTACCTGCAGATTGCAGAGCGGCGAGAGCCCATAGGCAGCATGTCATCCATGGAAGTGA
AC
GTGGACATGCTGGAGCAGATGGACCTGATGGACATATCGGACCAGGAGGCCCTGGACGTCTTCCTGAA
C
TCTGGAGGAGAAGAGAACACTGTGCTGTCCCCCGCCTTAGGTAGGGTTGACAAACTTGCATTAGCTGAA
CCA
GGGCAGTATCGATGCCACTCCCCTCCAAAGGTGAGACGTGAGAACCATCTGCCAGTCACTTACGCAT
AA


Translation (303 aa):
MLETLRERLLSVQQDFTSGLKTLSDKSREAKVKSKPRTVPFLPKYSAGLELLSRYEDTWAALHRRAKDCA
S
AGE
LVDSEVVMLSAHWEKKKTSLVELQEQLQQLPALIADLESMTANLTHLEASFEEVENNLLHLEDLCG
Q
CELERCKHMQSQQLENYKKNK
RKELETFKAELDAEHAQKVLEMEHTQQMKLKERQKFFEEAFQQDMEQY
L
STGYLQIAERR
EPIGSMSSMEVNVDMLEQMDLMDISDQEALDVFLNSGGEENTVLSPALGRVDKLALAE
P
GQYRCHSPPKVRRENHLPVTYA




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser