NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS45285.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
45285.1 Public Homo sapiens 15 DENND4A 22 109 92 CCDS HistoryNCBI Gene:10260Re-query CCDS DB by CCDS ID:45285.1Re-query CCDS DB by GeneID:10260See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 45285.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000431932.6 ENSP00000396830.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000431932.6Link to Ensembl Protein Viewer:ENSP00000396830.2Re-query CCDS DB by Nucleotide ID:ENST00000431932Re-query CCDS DB by Protein ID:ENSP00000396830
Original member Current member NCBI NM_005848.4 NP_005839.3 Accepted alive Link to Nucleotide Sequence:NM_005848.4Link to Protein Sequence:NP_005839.3Re-query CCDS DB by Nucleotide ID:NM_005848Re-query CCDS DB by Protein ID:NP_005839Link to BLAST:NP_005839.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_005839.3 1863 Q7Z401-1 1863 100% 0 0

Chromosomal Locations for CCDS 45285.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 15 (NC_000015.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 65661851 65661987 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65664330 65664394 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65664560 65664722 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65665345 65665462 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65667449 65667703 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65667925 65668123 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65669779 65669925 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65670013 65670188 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65671792 65671886 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65676445 65676634 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65690415 65691511 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65696366 65696497 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65697267 65697383 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65701051 65701192 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65701762 65701890 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65702305 65702511 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65702873 65703008 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65706091 65706224 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65715478 65715623 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65717778 65717996 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65722848 65722948 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65729072 65729247 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65729534 65729678 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65731642 65731700 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65732752 65732818 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65737707 65737945 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65738706 65738875 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65741715 65741784 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65752379 65752628 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 65756140 65756450 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (5592 nt):
ATGATTGAAGACAAGGGGCCTCGTGTTGCTGACTACTTTGTTGTAGCAGGATTAACTGATGTTTCAAAGC
CT
CTAGAAGAAGAAATTCACTTCAATGATGCTTGTCATAAAGTAGCTAAACCAAAAGAACCTATTACAGA
T
GTTTCAGTTATTATCAAATCTCTTGGGGAGGAAGTCCCACAGGATTATATCTGTATTGATGTTACCCCA
ACT
GGATTGTCAGCTGATCTTAATAATGGAAGTCTTGTGGGGCCACAGATTTACCTTTGCTATAGAAGAG
GA
AGAGATAAGCCTCCACTTACAGATCTGGGGGTTTTATATGACTGGAAAGAAAGATTGAAACAGGGTTG
T
GAAATTATTCAGAGTACTCCCTATGGGCGCCCCGCAAATATTAGTGGGAGTACCTCATCACAAAGAATT
TAT
ATCACTTACCGAAGAGCCTCTGAAAACATGACTCAGAATACGTTGGCTGTCACTGACATATGTATTA
TT
ATACCCAGTAAAGGAGAAAGCCCACCACACACGTTCTGCAAAGTCGACAAGAATCTCAATAACAGTAT
G
TGGGGATCAGCAGTATACTTGTGTTATAAAAAATCGGTGGCAAAGACGAACACTGTATCTTACAAAGCT
G
GC
CTAATTTGTAGATATCCTCAAGAAGATTATGAGTCATTCTCACTACCGGAATCTGTTCCTCTATTTT
GT
TTACCAATGGGTGCAACCATTGAATGTTGGCCATCAAATAGCAAATACCCTCTGCCTGTATTTTCTAC
T
TTTGTTTTAACTGGAGCCTCAGCTGAAAAGGTTTATGGTGCTGCTATTCAGTTTTATGAACCATACTCT
GAG
GAGAATCTCACAGAAAAGCAGAGACTTCTTTTGGGTTTAACATCAGCAGATGGGAAGTCTGATAGTT
CC
AAAACAATTCATACTAACAAATGCATCTGTCTTCTTTCTCACTGGCCTTTTTTTGATGCATTCAGGAA
G
TTTCTGACTTTTCTGTATCGTTATTCCATCTCTGGGCCTCATGTCCTTCCAATTGAGAAGCATATTTCT
CAT
TTTATGCATAAAGTTCCTTTTCCATCTCCTCAGAGACCACGGATTTTAGTTCAGTTATCACCACATG
AT
AATCTGATTCTCAGTCAGCCTGTGTCTTCACCTCTTCCACTAAGTGGTGGCAAGTTTTCAACACTACT
G
CAGAATTTAGGCCCTGAAAATGCTGTGACACTACTGGTGTTTGCAGTAACAGAACATAAAATTCTTATC
CAT
TCCCTACGGCCATCCGTGCTTACTAGTGTGACAGAAGCATTAGTGTCTATGATTTTCCCTTTCCACT
GG
CCATGCCCGTATGTTCCTCTCTGCCCACTGGCTTTAGCAGATGTCTTGAGTGCACCATGTCCATTCAT
A
GTAGGGATTGATTCAAGATACTTTGATCTCTATGATCCTCCACCAGATGTCAGTTGTGTTGATGTAGAT
ACC
AACACTATTTCTCAAATTGGTGACAAGAAAAATGTAGCCTGGAAGATACTTCCAAAGAAGCCATGTA
AA
AATCTGATGAACACACTGAATAATTTGCATCAGCAATTGGCAAAATTGCAGCAGAGACCGAGAGATGA
T
GGACTCATGGATTTAGCAATAAATGACTATGATTTTAATTCTGGAAAGAGGTTGCACATGATAGATTTG
GAA
ATCCAAGAGGCATTTTTGTTTTTCATGGCCTCTATTTTAAAAGGTTACAGATCATACTTAAGGCCAA
TA
ACACAAGCCCCATCTGAGACAGCCACAGATGCAGCCTCTCTCTTTGCCCTACAAGCTTTCTTAAGAAG
C
CGGGACCGGTCACATCAAAAATTCTATAACATGATGACCAAAACACAAATGTTTATTCGCTTCATTGAA
GAA
TGTTCTTTTGTTAGTGACAAAGATGCAAGCCTGGCATTTTTTGATGATTGTGTAGATAAAGTGGATA
TG
GACAAGAGCGGTGAAGTACGACTTATAGAACTGGATGAATCTTTCAAAAGTGAACACACTGTTTTTGT
A
ACACCACCTGAGATCCCCCACCTACCCAATGGTGAAGAACCCCCTTTACAGTACAGCTATAATGGATTT
CCA
GTTCTTAGGAACAATTTATTTGAAAGACCTGAAGGATTTCTACAAGCAAAGAAGAACAAATTGCCTT
CA
AAATCAAGTAGTCCTAATAGCCCTTTGCCCATGTTCAGAAGAACAAAACAGGAAATTAAATCAGCCCA
T
AAAATTGCAAAGAGGTACTCTTCCATCCCTCAGATGTGGTCTAGGTGTCTACTGCGCCACTGTTATGGA
CTG
TGGTTTATTTGTCTCCCAGCTTATGTGAAAGTCTGTCATTCAAAAGTCAGGGCTCTGAAAACAGCAT
AT
GATGTGCTTAAAAAAATGCAGTCAAAGAAGATGGATCCACCTGATGAGGTATGCTACCGCATTCTTAT
G
CAACTCTGTGGACAATATGATCAGCCAGTGCTTGCAGTTCGAGTGCTTTTTGAAATGCAGAAAGCTGGT
ATT
GACCCCAATGCCATTACTTATGGTTATTATAATAAGGCTGTTTTGGAAAGTACCTGGCCTTCAAGAA
GT
CGTAGTGGCTATTTTCTTTGGACAAAAGTAAGAAATGTTGTTTTAGGAGTAACACAGTTCAAAAGAGC
T
TTAAAGAAGCATGCACACTTATCACAAACAACTCTCTCAGGTGGCCAGTCTGATCTTGGATATAATTCA
TTA
TCTAAAGATGAAGTTAGAAGAGGGGATACATCTACTGAAGACATTCAAGAAGAAAAAGATAAAAAAG
GG
AGTGATTGTAGTTCCTTGTCAGAGAGTGAGAGTACAAAAGGAAGTGCTGATTGCCTTCCTAAGCTCAG
T
TATCAAAATTCTTCCAGTATCGTTCGCCTCACTGGTACAAGTAACAACAGTGCTGGTAAAATATCAGGA
GAA
AGCATGGAAAGCACACCTGAGCTGCTCTTAATATCATCTCTTGAAGATACAAATGAAACACGAAACA
TT
CAAAGTAGATGCTTCAGGAAAAGACATAAAAGTGACAATGAAACTAATTTGCAGCAGCAAGTGGTCTG
G
GGAAATAGAAACCGTAATCTTAGTGGAGGGGTACTGATGGGATTTATGCTCAATAGAATTAACCAGGAA
GCA
ACCCCTGGAGATATAGTTGAAAAATTGGGAGCTGATGCAAAAATTCTTTCAAATGTTATCTCAAAAA
GC
ACGAGACCAAATACTCTTGATATTGGGAAGCCACCTTTAAGATCAAAAAGAGACAGTCTAGAAAAGGA
A
TCTAGTGATGATGATACACCTTTTGATGGTTCTAACTATTTGGCAGATAAAGTGGATTCTCCTGTTATT
TTT
GACTTAGAAGACTTAGACAGTGAAACAGATGTATCAAAAGCAGGATGTGTTGCTACACAAAATCCCA
AG
AGGATTCAACGTATGAACAGCAGCTTTTCAGTAAAACCTTTTGAAAAAACTGATGTCGCAACAGGATT
T
GATCCCCTCTCTCTTTTGGTTGCTGAGACTGAACAGCAGCAAAAAGAAGAAGAGGAGGAGGATGAAGAT
GAT
AGCAAAAGCATTTCAACACCATCTGCTAGGCGTGATTTAGCTGAAGAAATTGTGATGTATATGAATA
AC
ATGAGCAGTCCTTTGACAAGTCGTACACCAAGCATTGATTTACAACGGGCATGTGATGATAAATTAAA
T
AAGAAAAGTCCACCATTGGTCAAGGCATGCAGAAGATCTAGTCTGCCTCCTAATTCTCCTAAGCCAGTG
AGA
CTTACCAAATCTAAAAGTTACACAAAAAGTGAGGAGAAACCAAGGGATAGACTTTGGTCTTCTCCAG
CC
TTCTCACCTACTTGCCCATTTAGGGAAGAATCTCAGGATACATTAACCCACTCATCACCTTCATTTAA
C
TTAGATACACTACTAGTACCTAAACTAGATGTTCTAAGAAACAGTATGTTCACTGCTGGAAAAGGAGTT
GCA
GAGAAAGCAAGCAAATGGTATTCAAGATTCACCATGTACACCACATCATCTAAGGATCAAAGTTCTG
AT
CGTACCAGTCTTTCTTCAGTGGGAGCCCAGGATTCTGAATCTACCTCTTTAACAGATGAAGATGTCTG
C
CATGAGTTGGAAGGACCTATCTCCTCTCAAGAGACCAGTGCTACTTCAGGGACTAAGAGAATTGATCTC
AGC
CGAATAAGCCTGGAAAGTTCTGCATCCTTGGAAGGATCTCTGTCGAAGTTTGCCTTACCTGGGAAAT
CA
GAAGTGACATCTTCCTTCAACGCGAGTAATACAAATATCTTCCAGAACTATGCAATGGAGGTTCTCAT
C
TCAAGTTGCTCTCGGTGTAGAACTTGTGATTGTCTTGTCCATGATGAGGAAATCATGGCTGGCTGGACA
GCA
GATGATTCAAATCTCAATACTACATGCCCATTCTGTGGCAATATCTTCTTACCCTTTCTGAATATAG
AA
ATAAGAGATTTAAGACGACCTGGAAGATACTTTCTAAAGTCAAGCCCATCAACAGAAAATATGCACTT
T
CCATCCTCCATTTCAAGTCAGACGAGGCAGTCTTGCATTTCAACATCAGCCTCTGGTCTTGACACATCT
GCT
CTCTCTGTTCAAGGGAATTTTGATCTAAATAGCAAATCTAAACTGCAGGAAAATTTTTGCACCCGAA
GT
ATTCAGATCCCTGCTAATAGATCAAAAACAGCTATGTCTAAATGTCCAATATTTCCAATGGCCAGGAG
T
ATTAGTACTTCTGGCCCCTTGGATAAGGAAGATACTGGAAGACAGAAGCTCATTTCTACAGGCAGCCTG
CCA
GCTACTTTACAAGGAGCTACAGATTCTTTAGGTTTAGAATGGCACCTTCCAAGTCCCGATCCTGTCA
CT
GTTCCGTATCTTAGTCCTTTAGTGGTATGGAAAGAACTTGAAAGCTTATTGGAAAATGAAGGTGATCA
T
GCAATAACAGTAGCAGACTTTGTGGACCATCATCCAATTGTTTTTTGGAACCTGGTATGGTATTTCAGA
CGT
CTTGACTTGCCCAGTAACTTACCTGGATTGATTCTTTCTTCTGAGCACTGTAACAAGTATTCAAAGA
TT
CCCCGCCACTGTATGTCTGAAGATAGCAAATATGTTTTAATACAAATGTTATGGGACAATATGAAGTT
A
CATCAGGATCCGGGACAGCCCTTGTACATTCTCTGGAATGCACACACCCAAAAATATCCAATGGTCCAT
TTA
TTGCAAAAAAGTGATAACTCATTTAACCAGGAACTGTTGAAAAGTATGGTAAAAAGCATTAAAATGA
AT
GATGTCTATGGACCAATGAGTCAGATTTTAGAGACACTGAATAAGTGTCCACATTTTAAAAGACAGAG
G
AGTTTATACAGAGAAATACTATTTCTCTCACTTGTGGCACTGGGAAGAGAAAACATTGATATAGATGCT
TTT
GATAAAGAGTACAAGATGGCATACGATCGTCTCACACCTAGTCAAGTCAAGAGTACACACAACTGTG
AT
AGACCACCAAGTACAGGGGTGATGGAATGTCGAAAAACCTTTGGAGAACCTTATCTTTAA


Translation (1863 aa):
MIEDKGPRVADYFVVAGLTDVSKPLEEEIHFNDACHKVAKPKEPITDVSVIIKSLGEEVPQDYICIDVTP
T
GLSADLNNGSLVGPQIYLCYRRGRDKPPLTDL
GVLYDWKERLKQGCEIIQSTPYGRPANISGSTSSQRI
Y
ITYRRASENMTQNTLAVTDICIIIPSKGESPPHTFCKVDKNLNNSM
WGSAVYLCYKKSVAKTNTVSYKA
G
LICRYPQEDYESFSLPESVPLFCLPMGATIECWPSNSKYPLPVFSTFVLTGASAEKVYGAAIQFYEPYS
E
ENLTEKQRLLLGLTSADGKSDSSKTIHTNKCICLLSHWPFFDAFRKFLTFLYRYSISGPHVLPIE
KHIS
H
FMHKVPFPSPQRPRILVQ
LSPHDNLILSQPVSSPLPLSGGKFSTLLQNLGPENAVTLLVFAVTEHKILI
H
SLRPSVLTSVTEALVS
MIFPFHWPCPYVPLCPLALADVLSAPCPFIVGIDSRYFDLYDPPPDVSCVDVD
T
NTIS
QIGDKKNVAWKILPKKPCKNLMNTLNNLHQQLAKLQQRPRDDGLMDLAINDYDFNSGKRLHMIDL
E
IQEAFLFFMASILKGYRSYLRPITQAPSETATDAASLFALQ
AFLRSRDRSHQKFYNMMTKTQMFIRFIE
E
CSFVSDKDASLAFFDDCVDK
VDMDKSGEVRLIELDESFKSEHTVFVTPPEIPHLPNGEEPPLQYSYNGF
P
VLRNNLFERPEGFLQAKKNKLPSKSSSPNSPLPMFRRTKQ
EIKSAHKIAKRYSSIPQMWSRCLLRHCYG
L
WFICLPAYVKVCHSKVRALKTAYDVLKKMQSKKMDPPDE
VCYRILMQLCGQYDQPVLAVRVLFEMQKAG
I
DPNAITYGYYNK
AVLESTWPSRSRSGYFLWTKVRNVVLGVTQFKRALKKHAHLSQTTLSGGQSDLGYNS
L
SKDEVRRGDTSTEDIQEEKDKKGSDCSS
LSESESTKGSADCLPKLSYQNSSSIVRLTGTSNNSAGKISG
E
SM
ESTPELLLISSLEDTNETRNIQSRCFRKRHKSDNETNLQQQVVWGNRNRNLSGGVLMGFMLNRINQE
A
TPGDIVEKLGADAKILSNVISKSTRPNTLDIGKPPLRSKRDSLEKESSDDDTPFDGSNYLADKVDSPVI
F
DLEDLDSETDVSKAGCVATQNPKRIQRMNSSFSVKPFEKTDVATGFDPLSLLVAETEQQQKEEEEEDED
D
SKSISTPSARRDLAEEIVMYMNNMSSPLTSRTPSIDLQRACDDKLNKKSPPLVKACRRSSLPPNSPKPV
R
LTKSKSYTKSEEKPRDRLWSSPAFSPTCPFREESQDTLTHSSPSFNLDTLLVPKLDVLRNSMFTAGKGV
A
EKASKWYSRFTMYTTSSK
DQSSDRTSLSSVGAQDSESTSLTDEDVCHELEGPISSQETSATSGTKRIDL
S
RISLESSASLE
GSLSKFALPGKSEVTSSFNASNTNIFQNYAMEVLISSCSRCRTCDCLVHDEEIMAGWT
A
DDSNLNTTCPFCGNIFLPFLNIEIRDLRRPG
RYFLKSSPSTENMHFPSSISSQTRQSCISTSASGLDTS
A
LSVQGNFDLN
SKSKLQENFCTRSIQIPANRSKTAMSKCPIFPMARSISTSGPLDKEDTGRQKLISTGSL
P
ATLQGAT
DSLGLEWHLPSPDPVTVPYLSPLVVWKELESLLENEGDHAITVADFVDHHPIVFWNLVWYFR
R
LDLPSNLPGLILSSEHCNKYSK
IPRHCMSEDSKYVLIQMLWDNMKLHQDPGQPLYILWNAHTQKYPMVH
L
LQKSDNSFNQELLKSMVKSIKMNDVYGPMSQILETLNKCPHFKRQ
RSLYREILFLSLVALGRENIDIDA
F
DKEYKMAYDRLTPSQVKSTHNCDRPPSTGVMECRKTFGEPYL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser