NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS45266.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
45266.1 Public Homo sapiens 15 ALDH1A2 22 109 92 CCDS HistoryNCBI Gene:8854Re-query CCDS DB by CCDS ID:45266.1Re-query CCDS DB by GeneID:8854See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 45266.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000559517.5 ENSP00000453408.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000559517.5Link to Ensembl Protein Viewer:ENSP00000453408.1Re-query CCDS DB by Nucleotide ID:ENST00000559517Re-query CCDS DB by Protein ID:ENSP00000453408
Original member NCBI NM_170697.2 NP_733798.1 Updated not alive Link to Nucleotide Sequence:NM_170697.2Link to Protein Sequence:NP_733798.1Re-query CCDS DB by Nucleotide ID:NM_170697Re-query CCDS DB by Protein ID:NP_733798
Current member NCBI NM_170697.3 NP_733798.1 Accepted alive Link to Nucleotide Sequence:NM_170697.3Link to Protein Sequence:NP_733798.1Re-query CCDS DB by Nucleotide ID:NM_170697Re-query CCDS DB by Protein ID:NP_733798Link to BLAST:NP_733798.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_733798.1 422 O94788-4 422 100% 0 0

Chromosomal Locations for CCDS 45266.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 15 (NC_000015.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 57955197 57955269 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 57960770 57960844 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 57961137 57961294 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 57962012 57962176 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 57963885 57964069 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 57965725 57965827 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 57992705 57992818 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 57992945 57993073 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 57995078 57995139 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58010649 58010778 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 58013858 58013932 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1269 nt):
ATGGATGCTTCAGAAAGGGGACGTCTGTTGGATAAGCTTGCAGACTTGGTGGAACGGGACAGGGCAGTTC
TT
GCAACCATGGAATCCCTAAATGGTGGCAAACCATTCCTGCAAGCTTTTTATGTGGATTTGCAGGGCGT
C
ATCAAAACCTTTCGATATTACGCAGGCTGGGCTGATAAAATTCATGGGATGACCATTCCTGTAGATGGA
GAC
TATTTTACCTTTACAAGACATGAACCCATTGGAGTGTGTGGACAGATCATCCCATGGAACTTCCCCC
TG
CTGATGTTTGCCTGGAAAATAGCTCCAGCTTTGTGCTGTGGCAATACAGTAGTTATTAAGCCAGCAGA
G
CAAACACCACTCAGTGCACTCTACATGGGAGCCCTCATCAAGGAGGCTGGCTTTCCTCCCGGGGTCATC
AAT
ATTTTGCCAGGATATGGGCCAACGGCTGGGGCAGCAATAGCTTCTCACATTGGCATAGACAAGATTG
CA
TTCACAGGGTCTACTGAGGTTGGAAAGCTTATCCAAGAAGCAGCTGGAAGAAGTAATTTGAAGAGAGT
A
ACTCTGGAACTTGGAGGCAAAAGTCCTAATATTATTTTTGCTGATGCTGACTTGGACTATGCTGTGGAG
CAG
GCCCACCAGGGTGTGTTCTTCAATCAAGGTCAGTGCTGCACTGCAGGCTCTCGCATCTTCGTGGAGG
AG
TCCATCTATGAGGAGTTTGTGAGAAGAAGCGTGGAGCGGGCCAAGAGGCGCGTAGTGGGGAGTCCCTT
T
GACCCCACCACTGAGCAGGGTCCCCAGATTGATAAGAAACAGTACAACAAGATCTTGGAACTCATCCAG
AGT
GGTGTGGCTGAGGGCGCCAAGCTGGAATGTGGAGGCAAAGGACTGGGCCGAAAGGGGTTTTTCATTG
AG
CCCACAGTGTTTTCCAACGTCACTGATGATATGCGGATTGCCAAGGAGGAGATCTTTGGCCCTGTTCA
G
GAAATTTTGAGATTTAAGACGATGGATGAAGTTATCGAAAGAGCCAATAACTCAGACTTTGGACTCGTA
GCA
GCTGTCTTTACTAATGACATCAACAAGGCCCTCACAGTGTCTTCTGCAATGCAAGCTGGGACTGTTT
G
G
ATCAATTGTTACAATGCCTTAAATGCCCAGAGCCCCTTTGGGGGATTCAAGATGTCTGGAAATGGGAG
A
GAAATGGGAGAATTTGGCTTGCGGGAGTACTCAGAAGTTAAGACGGTGACAGTAAAGATCCCCCAGAAG
AAC
TCCTAA


Translation (422 aa):
MDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDG
D
YFTFTRHEPIGVCGQIIP
WNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVI
N
ILPGYGPTAGAAIASHIGIDKIAFTGSTE
VGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVE
Q
AHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQ
IDKKQYNKILELIQ
S
GVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEE
IFGPVQEILRFKTMDEVIERANNSDFGLV
A
AVFTNDINKALTVSSAMQAGTV
WINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQK
N
S




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser