NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Wednesday, September 28, 2022, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS45222.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
45222.1 Public Homo sapiens 15 RASGRP1 22 109 92 CCDS HistoryNCBI Gene:10125Re-query CCDS DB by CCDS ID:45222.1Re-query CCDS DB by GeneID:10125See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 45222.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000310803.9 ENSP00000310244.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000310803.9Link to Ensembl Protein Viewer:ENSP00000310244.5Re-query CCDS DB by Nucleotide ID:ENST00000310803Re-query CCDS DB by Protein ID:ENSP00000310244
Original member NCBI NM_005739.3 NP_005730.2 Updated not alive Link to Nucleotide Sequence:NM_005739.3Link to Protein Sequence:NP_005730.2Re-query CCDS DB by Nucleotide ID:NM_005739Re-query CCDS DB by Protein ID:NP_005730
Current member NCBI NM_005739.4 NP_005730.2 Accepted alive Link to Nucleotide Sequence:NM_005739.4Link to Protein Sequence:NP_005730.2Re-query CCDS DB by Nucleotide ID:NM_005739Re-query CCDS DB by Protein ID:NP_005730Link to BLAST:NP_005730.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_005730.2 797 O95267-1 797 100% 0 0

Chromosomal Locations for CCDS 45222.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 15 (NC_000015.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 38490554 38490688 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 38494382 38494767 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 38498794 38498946 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 38500103 38500139 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 38501143 38501287 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 38502312 38502421 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 38503272 38503376 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 38505840 38505920 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 38507726 38508001 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 38511604 38511720 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 38512783 38512956 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 38516197 38516350 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 38518292 38518423 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 38519309 38519371 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 38526299 38526404 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 38559821 38560005 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 38564594 38564628 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2394 nt):
ATGGGCACCCTGGGCAAGGCGAGAGAGGCTCCGCGGAAACCTTCCCATGGCTGCAGAGCTGCCTCTAAAG
CA
AGACTAGAGGCAAAGCCAGCCAACAGCCCCTTCCCCTCCCATCCCAGCTTGGCCCACATCACCCAGTT
C
CGAATGATGGTGTCTCTGGGACATTTAGCCAAAGGAGCCAGCCTGGACGATCTCATTGACAGCTGCATT
CAA
TCTTTTGATGCAGATGGAAACCTGTGTCGAAGTAACCAACTGTTGCAAGTCATGCTGACCATGCACC
GA
ATTGTCATCTCCTCTGCAGAACTGCTCCAAAAAGTTATCACCCTCTATAAGGATGCTTTGGCAAAGAA
T
TCACCAGGACTTTGCCTGAAGATCTGTTATTTTGTAAGGTATTGGATAACAGAATTCTGGGTCATGTTT
AAA
ATGGACGCCAGCTTGACAGACACTATGGAGGAGTTTCAGGAACTGGTGAAAGCTAAGGGTGAGGAGT
TA
CATTGCCGCCTGATTGACACAACTCAAATCAATGCCCGTGACTGGTCCAGGAAACTTACTCAAAGGAT
A
AAATCAAATACCAGCAAGAAACGGAAAGTCTCCCTGCTCTTTGACCATCTGGAACCAGAAGAGCTATCC
GAG
CACCTCACCTACCTTGAGTTCAAGTCTTTCCGGAGGATATCGTTCTCTGATTATCAGAATTACCTTG
TA
AATAGCTGTGTGAAGGAAAACCCCACCATGGAGCGATCTATTGCTCTGTGCAACGGCATCTCCCAGTG
G
GTACAACTGATGGTTCTCAGCCGCCCCACGCCGCAGCTCCGAGCAGAAGTCTTCATCAAGTTCATCCAG
GTG
GCTCAGAAGCTCCACCAACTACAGAACTTCAATACACTGATGGCTGTGATAGGTGGGCTGTGTCACA
GC
TCAATCTCGAGGCTCAAGGAGACAAGTTCGCATGTCCCACATGAAATCAATAAGGTTCTCGGTGAGAT
G
ACTGAGCTGCTGTCCTCCTCCAGAAACTACGACAATTACCGGCGAGCCTATGGAGAGTGCACCGACTTC
AAG
ATCCCCATTCTGGGTGTGCATCTCAAGGACCTCATCTCCCTGTATGAAGCCATGCCTGACTATCTGG
AG
GACGGGAAAGTGAACGTCCATAAGCTACTGGCCCTATACAATCATATCAGTGAATTGGTCCAGCTGCA
A
GAGGTGGCCCCACCCTTGGAGGCTAACAAGGACTTGGTACACTTGCTGACGTTATCCCTGGATCTTTAC
TAC
ACTGAGGATGAAATCTATGAGCTTTCCTATGCCCGGGAACCAAGGAACCACAGAGCTCCACCACTAA
CA
CCTTCAAAGCCACCAGTAGTAGTGGACTGGGCTTCTGGAGTGTCTCCCAAACCTGATCCAAAAACCAT
T
AGCAAACACGTCCAGAGGATGGTGGATTCTGTCTTCAAGAACTATGATCACGACCAGGATGGATACATT
TCT
CAGGAAGAATTTGAAAAGATTGCTGCGAGTTTTCCATTTTCCTTCTGTGTGATGGACAAAGACAGGG
AA
GGCCTCATCAGCAGGGATGAGATCACAGCCTACTTCATGAGAGCCAGCTCAATCTATTCCAAGCTGGG
C
CTGGGCTTTCCTCACAACTTCCAAGAGACCACCTACCTGAAGCCCACTTTTTGTGACAACTGTGCTGGA
TTT
CTCTGGGGAGTGATCAAACAAGGATATCGATGTAAAGACTGCGGGATGAACTGTCACAAACAATGCA
AA
GATCTGGTTGTGTTTGAGTGTAAGAAGCGAGCCAAGAACCCAGTAGCTCCCACAGAGAACAACACTTC
T
GTGGGGCCAGTGTCCAACCTTTGCTCATTGGGAGCCAAAGATCTGCTCCATGCACCTGAGGAAGGACCT
TTT
ACATTCCCTAATGGGGAGGCTGTGGAACATGGTGAGGAGAGTAAGGATCGGACCATCATGCTGATGG
GA
GTGTCCTCACAGAAGATTTCTCTTCGGCTGAAGAGGGCTGTTGCCCACAAGGCCACCCAGACTGAATC
A
CAGCCTTGGATTGGCAGTGAGGGCCCTTCAGGTCCCTTTGTGCTGTCTTCCCCAAGGAAGACAGCCCAG
GAT
ACTCTATATGTGCTTCCCAGTCCCACCTCTCCATGTCCTAGCCCAGTCTTGGTCAGAAAGCGGGCTT
TT
GTCAAGTGGGAGAATAAAGACTCCCTCATAAAATCAAAGGAGGAGCTCCGTCACCTCAGACTGCCTAC
C
TACCAAGAACTGGAACAGGAAATAAATACTCTGAAAGCAGATAATGATGCCCTAAAGATCCAACTGAAA
TAT
GCACAGAAGAAAATAGAATCCCTCCAGCTTGAAAAAAGCAATCATGTCTTAGCTCAAATGGAGCAGG
GT
GACTGTTCTTAG


Translation (797 aa):
MGTLGKAREAPRKPSHGCRAASKARLEAKPANSPFPSHPSLAHITQFRMMVSLGHLAKGASLDDLIDSCI
Q
SF
DADGNLCRSNQLLQVMLTMHRIVISSAELLQKVITLYKDALAKNSPGLCLKICYFVRYWITEFWVMF
K
MDASLTDTMEEFQELVKAKGEELHCRLIDTTQ
INARDWSRKLTQRIKSNTSKKRKVSLLFDHLEPEELS
E
HLTYLEFKSFRRIS
FSDYQNYLVNSCVKENPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIQ
V
AQ
KLHQLQNFNTLMAVIGGLCHSSISRLKETSSHVPHEINKVLGEMTELLSSSRNYDNYRRAYGECTDF
K
IPILGVHLKDLISLYEAMPDYLEDGKVNVHKLLALYNHISELVQLQEVAPPLEANKDLVHLLT
LSLDLY
Y
TEDEIYELSYAREPRNHRAP
PLTPSKPPVVVDWASGVSPKPDPKTISKHVQRMVDSVFKNYDHDQDGYI
S
QEEFEKIAASFPFSFCVMDKD
REGLISRDEITAYFMRASSIYSKLGLGFPHNFQETTYLKPTFCDNCAG
F
LWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKRAKNPVAPTENNTSVGPVSNLCSLGAKDLLHAPEEGP
F
TFPNGEAVEHGEESKDRTIMLMGVSSQKISLRLKRAVAHKATQTESQPWIGSEGPSGPFVLSSPRKTAQ
D
TLYVLPSPTSPCPSPVLVRKRAFVKWENKDSLIKSKEELRHLRLPTYQELEQ
EINTLKADNDALKIQLK
Y
AQKKIESLQLEKSNHVLAQMEQGDCS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser