NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS4518.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
4518.1 Public Homo sapiens 6 ELOVL2 22 109 92 CCDS HistoryNCBI Gene:54898Re-query CCDS DB by CCDS ID:4518.1Re-query CCDS DB by GeneID:54898See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 4518.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000354666.3 ENSP00000346693.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000354666.3Link to Ensembl Protein Viewer:ENSP00000346693.3Re-query CCDS DB by Nucleotide ID:ENST00000354666Re-query CCDS DB by Protein ID:ENSP00000346693
Original member NCBI NM_017770.3 NP_060240.3 Updated not alive Link to Nucleotide Sequence:NM_017770.3Link to Protein Sequence:NP_060240.3Re-query CCDS DB by Nucleotide ID:NM_017770Re-query CCDS DB by Protein ID:NP_060240
Current member NCBI NM_017770.4 NP_060240.3 Accepted alive Link to Nucleotide Sequence:NM_017770.4Link to Protein Sequence:NP_060240.3Re-query CCDS DB by Nucleotide ID:NM_017770Re-query CCDS DB by Protein ID:NP_060240Link to BLAST:NP_060240.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_060240.3 296 Q9NXB9 296 100% 0 0

Chromosomal Locations for CCDS 4518.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 6 (NC_000006.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 10983781 10983906 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 10989703 10989837 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 10990318 10990442 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 10995007 10995178 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 11000087 11000164 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 11005372 11005559 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 11010746 11010809 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 11044228 11044230 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (891 nt):
ATGGAACATCTAAAGGCCTTTGATGATGAAATCAATGCTTTTTTGGACAATATGTTTGGACCGCGAGATT
CT
CGAGTCAGAGGGTGGTTCATGTTGGACTCTTACCTTCCTACCTTTTTTCTTACTGTCATGTATCTGCT
C
TCAATATGGCTGGGTAACAAGTATATGAAGAACAGACCTGCTCTTTCTCTCAGGGGTATCCTCACCTTG
TAT
AATCTTGGAATCACACTTCTCTCCGCGTACATGCTGGCAGAGCTCATTCTCTCCACTTGGGAAGGAG
GC
TACAACTTACAGTGTCAAGATCTTACCAGCGCAGGGGAAGCTGACATCCGGGTAGCCAAGGTGCTTTG
G
TGGTACTATTTCTCCAAATCAGTAGAGTTCCTGGACACAATTTTCTTCGTTTTGCGGAAAAAAACGAGT
CAG
ATTACTTTTCTTCATGTATATCATCATGCTTCTATGTTTAACATCTGGTGGTGTGTCTTGAACTGGA
TA
CCTTGTGGACAAAGTTTCTTTGGACCAACACTGAACAGTTTTATCCACATTCTTATGTACTCCTACTA
T
GGACTTTCTGTGTTTCCATCTATGCACAAGTATCTTTGGTGGAAGAAATATCTCACACAGGCTCAGCTG
GTG
CAGTTCGTGCTCACCATCACGCACACCATGAGCGCCGTCGTGAAACCGTGTGGCTTCCCCTTCGGTT
GT
CTCATCTTCCAGTCATCTTATATGCTAACGTTAGTCATCCTCTTCTTAAATTTTTACGTTCAGACATA
C
CGAAAAAAGCCAATGAAGAAAGATATGCAAGAGCCACCTGCAGGGAAAGAAGTGAAGAATGGTTTTTCC
AAA
GCCTACTTCACTGCAGCAAATGGAGTGATGAACAAGAAAGCACAATAA


Translation (296 aa):
MEHLKAFDDEINAFLDNMFGPRDSRVRGWFMLDSYLPTFFLTVMYLLSIWLGNKYMKNRPALSLRGILTL
Y
NLGITLLSAYMLAE
LILSTWEGGYNLQCQDLTSAGEADIRVAKVLWWYYFSKSVEFLDTIFFVLRKKTS
Q
ITFLHVYHHASMFNIWWCVLNWIPCGQ
SFFGPTLNSFIHILMYSYYGLSVFPSMHKYLWWKKYLTQAQL
V
QFVLTITHTMSAVVKPCGFPFGCLIFQSSYMLTLVILFLNFYVQ
TYRKKPMKKDMQEPPAGKEVKNGFS
K
AYFTAANGVMNKKAQ




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser