NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS45081.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
45081.1 Public Homo sapiens 14 CHD8 22 109 92 CCDS HistoryNCBI Gene:57680Re-query CCDS DB by CCDS ID:45081.1Re-query CCDS DB by GeneID:57680See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 45081.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000430710.8 ENSP00000406288.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000430710.8Link to Ensembl Protein Viewer:ENSP00000406288.3Re-query CCDS DB by Nucleotide ID:ENST00000430710Re-query CCDS DB by Protein ID:ENSP00000406288
Original member Current member EBI,WTSI ENST00000645929.1 ENSP00000494402.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000645929.1Link to Ensembl Protein Viewer:ENSP00000494402.1Re-query CCDS DB by Nucleotide ID:ENST00000645929Re-query CCDS DB by Protein ID:ENSP00000494402
Original member Current member NCBI NM_020920.3 NP_065971.2 Accepted alive Link to Nucleotide Sequence:NM_020920.3Link to Protein Sequence:NP_065971.2Re-query CCDS DB by Nucleotide ID:NM_020920Re-query CCDS DB by Protein ID:NP_065971Link to BLAST:NP_065971.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_065971.2 2302 Q9HCK8-2 2302 100% 0 0

Chromosomal Locations for CCDS 45081.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 14 (NC_000014.9)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 21385613 21386176 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 21390947 21391063 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 21391463 21391642 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 21391833 21391946 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 21392507 21392809 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 21393106 21393254 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 21393476 21394195 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 21394277 21394485 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 21394912 21395119 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 21395298 21395352 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 21395817 21395892 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 21397823 21397952 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 21399602 21399705 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 21399981 21400070 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 21400151 21400307 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 21400413 21400612 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 21400875 21401071 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 21401403 21401513 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 21401957 21402136 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 21402336 21402503 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 21403017 21403212 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 21403453 21403663 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 21405209 21405464 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 21405721 21405864 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 21406856 21407032 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 21408312 21408555 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 21408704 21408825 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 21409851 21409988 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 21412913 21412996 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 21414301 21414418 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 21414938 21414993 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 21415574 21415642 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 21415725 21415907 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 21426128 21426242 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 21427869 21428254 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 21428964 21429335 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 21431811 21431816 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (6909 nt):
ATGAAGGGTGAATCGAAACGCATCACCCTGGTCCTCCAGCAGCCACAGTCTGGAGGTCCCCAAGGACATC
GG
CATGTTGTGCTAGGGAGTCTACCAGGCAAGATAGTGTTACAGGGCAACCAGCTGGCAGCCCTGACTCA
A
GCCAAGAATGCCCAAGGGCAGCCTGCCAAGGTAGTAACTATCCAGCTGCAGGTGCAGCAGCCACAGCAA
AAA
ATCCAGATTGTACCACAACCACCATCATCGCAGCCACAGCCCCAGCAGCCACCCTCCACCCAGCCAG
TG
ACTCTGTCCTCTGTACAGCAGGCTCAGATAATGGGACCAGGACAAAGCCCAGGACAAAGACTTTCAGT
A
CCAGTCAAGGTGGTACTGCAGCCACAGGCTGGCTCTTCCCAAGGGGCCTCTTCTGGGCTCTCTGTAGTT
AAA
GTTCTGAGTGCCAGTGAAGTGGCAGCTTTGTCATCACCAGCAAGCTCTGCTCCTCATTCGGGGGGAA
AG
ACAGGAATGGAGGAAAACCGCAGATTGGAACACCAGAAGAAGCAAGAGAAAGCAAATCGGATTGTAGC
A
GAGGCCATTGCGAGAGCCCGTGCCCGCGGTGAGCAGAACATACCTCGAGTCTTAAATGAGGACGAGTTG
CCC
AGCGTTCGGCCAGAGGAGGAAGGCGAGAAGAAACGCAGGAAGAAGAGTGCTGGGGAGAGGCTGAAAG
AG
GAGAAGCCAAAGAAGAGTAAAACATCTGGTGCCTCCAAAACAAAGGGCAAGAGCAAGCTCAACACCAT
C
ACTCCTGTAGTGGGTAAGAAGAGAAAACGTAATACCTCATCTGATAATTCAGATGTGGAAGTCATGCCT
GCA
CAGTCACCTCGAGAAGATGAAGAAAGCAGCATTCAGAAGAGACGCTCAAACCGCCAAGTTAAGCGAA
AA
AAATATACAGAGGACCTGGATATAAAGATCACAGATGATGAAGAAGAAGAAGAGGTGGATGTAACTGG
T
CCAATAAAACCTGAGCCTATCCTCCCTGAACCAGTGCAAGAACCAGATGGCGAGACTTTGCCTTCCATG
CAG
TTCTTTGTGGAGAATCCCAGTGAAGAAGATGCAGCCATTGTAGACAAAGTGCTTTCTATGCGGATTG
TG
AAGAAGGAGCTCCCTTCTGGACAATATACTGAAGCAGAAGAATTCTTTGTCAAGTACAAGAACTACTC
C
TATCTGCATTGTGAATGGGCTACTATCTCCCAACTAGAGAAGGATAAGAGGATACATCAAAAATTAAAG
CGC
TTCAAAACCAAAATGGCTCAGATGAGACACTTCTTCCATGAGGATGAAGAGCCCTTTAATCCAGACT
AC
GTAGAGGTGGATAGGATATTGGATGAGTCTCACAGTATTGACAAGGACAATGGGGAGCCCGTTATTTA
C
TACCTGGTGAAATGGTGCTCTCTGCCCTATGAGGATAGCACATGGGAGCTAAAAGAAGATGTTGATGAG
GGC
AAGATTCGAGAATTTAAACGGATTCAGTCAAGGCACCCAGAACTCAAAAGGGTGAATCGTCCGCAGG
CA
AGTGCCTGGAAGAAATTGGAGCTATCACATGAATATAAAAACAGAAACCAGCTACGGGAATATCAGTT
G
GAAGGGGTTAATTGGCTGCTCTTTAATTGGTATAACAGGCAGAACTGCATCCTGGCTGATGAGATGGGA
TTG
GGCAAAACTATTCAGTCCATTGCCTTCTTGCAGGAAGTATATAATGTGGGCATCCATGGTCCCTTCT
TG
GTCATTGCCCCACTGTCCACAATTACTAACTGGGAGCGAGAATTTAATACATGGACAGAAATGAACAC
T
ATTGTGTACCATGGCAGTCTGGCCAGCAGGCAGATGATTCAACAGTATGAAATGTACTGCAAAGATTCA
CGG
GGACGCCTCATCCCAGGCGCATACAAGTTTGACGCTCTGATCACCACTTTTGAGATGATTTTGTCAG
AT
TGTCCTGAGCTTCGTGAAATTGAATGGCGTTGTGTTATCATTGATGAAGCCCATCGACTGAAAAACCG
T
AATTGCAAGCTGCTTGATAGTCTCAAGCACATGGACCTGGAACACAAGGTGCTACTCACAGGAACACCA
TTG
CAAAATACTGTAGAAGAACTGTTTAGCTTGCTTCATTTCTTGGAACCGTCACAATTTCCCTCAGAAT
CA
GAGTTTCTCAAGGACTTTGGGGATCTCAAGACAGAGGAACAGGTTCAAAAGCTACAGGCCATTCTTAA
G
CCAATGATGCTGAGAAGACTCAAAGAGGATGTTGAAAAAAACTTGGCACCCAAACAGGAAACAATTATT
GAA
GTAGAGCTGACTAATATCCAGAAGAAATACTATCGGGCTATTTTGGAGAAGAATTTCTCCTTCCTTT
CC
AAAGGGGCAGGTCATACCAACATGCCTAATCTACTTAACACAATGATGGAGTTGCGCAAGTGCTGCAA
C
CACCCATATCTCATCAATGGTGCTGAAGAAAAAATCCTAACAGAATTCCGTGAAGCTTGCCATATTATA
CCT
CATGACTTTCACCTGCAGGCCATGGTTCGTTCAGCCGGCAAACTGGTTCTTATTGACAAGTTGCTTC
CA
AAGCTTAAAGCTGGTGGCCATAAAGTTCTGATCTTCTCTCAGATGGTGCGCTGCCTAGACATCCTAGA
G
GATTATTTAATCCAGAGGAGGTACTTATATGAACGTATTGATGGGCGAGTTAGAGGCAACCTTCGACAG
GCT
GCCATTGACCGCTTCAGCAAGCCTGACTCAGACCGCTTTGTCTTCTTACTGTGTACCCGGGCTGGTG
GA
CTTGGTATTAATCTTACAGCTGCTGATACCTGCATCATCTTTGATTCAGACTGGAATCCACAAAATGA
C
CTGCAGGCCCAGGCACGATGTCATCGAATTGGGCAGAGCAAAGCTGTGAAGGTGTACCGCCTCATCACT
CGT
AATTCCTACGAGAGAGAGATGTTTGATAAGGCCAGCCTCAAGTTGGGGTTGGATAAGGCTGTGCTTC
AA
TCCATGAGTGGTCGGGATGGCAACATTACTGGAATCCAACAGTTCTCTAAGAAGGAGATTGAAGATCT
T
TTAAGAAAAGGAGCATATGCAGCCATCATGGAGGAAGATGATGAAGGCTCCAAGTTTTGTGAAGAGGAC
ATT
GACCAGATCTTGTTAAGACGAACTACAACCATCACCATTGAATCTGAAGGAAAAGGTTCCACCTTTG
CT
AAGGCAAGCTTTGTTGCTTCTGAAAACAGGACAGATATTTCTTTGGATGACCCCAACTTTTGGCAAAA
G
TGGGCCAAAAAGGCTGACCTAGACATGGATCTGCTCAACAGCAAGAATAATTTGGTAATTGACACACCT
AGA
GTACGAAAACAAACGCGCCACTTTAGCACTCTGAAAGATGATGACCTGGTGGAATTCTCTGATTTGG
AA
AGTGAGGATGATGAGCGGCCACGCTCCCGCAGACATGACCGTCATCATGCCTATGGGCGCACTGACTG
C
TTTCGGGTGGAAAAGCATCTCCTGGTATATGGTTGGGGACGATGGCGAGATATTTTATCTCATGGACGC
TTC
AAGCGACGTATGACTGAACGAGATGTGGAGACCATTTGTCGGGCCATTCTCGTGTACTGTCTTCTAC
AC
TACCGTGGGGATGAAAATATTAAAGGCTTCATCTGGGACTTGATTAGCCCAGCTGAAAATGGCAAGAC
A
AAAGAATTGCAGAATCATTCAGGTCTATCTATCCCTGTGCCTCGTGGACGCAAAGGAAAAAAAGTAAAG
TCA
CAAAGCACTTTTGATATCCATAAGGCAGATTGGATCCGGAAATATAACCCTGACACTTTGTTCCAAG
AT
GAAAGTTATAAGAAGCACTTGAAACATCAGTGTAACAAGGTACTGTTGCGGGTACGAATGCTATACTA
C
CTGAGGCAGGAGGTTATTGGAGACCAAGCAGAAAAGGTGTTAGGGGGTGCGATTGCCAGTGAGATTGAC
ATA
TGGTTCCCAGTAGTGGATCAACTGGAGGTTCCAACAACTTGGTGGGACAGTGAGGCTGACAAGTCGC
TG
CTCATTGGAGTCTTTAAACATGGCTATGAGAAATATAATACCATGAGGGCAGACCCAGCCTTATGTTT
C
CTAGAAAAGGCTGGCCGACCAGATGACAAAGCAATTGCAGCAGAACATCGAGTGTTGGATAACTTCTCT
GAC
ATAGTAGAAGGGGTTGACTTTGATAAAGATTGTGAAGATCCTGAATATAAACCACTCCAAGGTCCCC
CA
AAGGACCAAGATGATGAGGGTGATCCCTTGATGATGATGGATGAGGAGATCTCAGTGATTGATGGAGA
T
GAAGCCCAGGTGACCCAACAGCCAGGCCATTTATTCTGGCCTCCGGGCTCTGCCCTAACAGCTAGGCTT
CGG
CGTCTAGTAACAGCGTATCAGCGCAGCTACAAGAGAGAACAAATGAAGATAGAGGCTGCAGAACGTG
GG
GACCGGCGAAGGCGGCGTTGTGAAGCAGCCTTCAAGCTGAAAGAAATTGCACGGCGGGAGAAACAACA
A
CGATGGACAAGGCGTGAACAAACTGATTTTTATCGAGTGGTGTCTACGTTTGGTGTGGAATATGACCCT
GAC
ACCATGCAGTTCCATTGGGATCGCTTCCGCACTTTTGCTCGACTAGACAAAAAGACAGATGAAAGCC
TT
ACCAAGTACTTCCATGGCTTTGTGGCCATGTGCCGCCAAGTATGCCGCCTTCCCCCAGCAGCTGGAGA
T
GAACCCCCCGACCCTAACCTGTTCATTGAGCCCATCACTGAGGAGAGAGCCTCACGGACTCTCTACCGT
ATA
GAATTGCTTCGGCGCTTACGGGAACAAGTTTTATGCCACCCCCTTTTGGAAGATCGGCTGGCATTGT
GT
CAGCCTCCTGGTCCTGAATTGCCCAAATGGTGGGAGCCTGTTCGGCATGATGGGGAGCTTCTAAGAGG
G
GCAGCCCGCCATGGGGTGAGCCAAACAGACTGCAACATCATGCAGGACCCAGACTTCTCTTTTCTGGCT
GCC
CGTATGAATTATATGCAGAACCATCAAGCAGGAGCACCAGCTCCATCCTTGTCACGCTGCTCTACTC
CA
CTGCTGCACCAGCAGTATACCTCACGCACTGCCTCACCACTGCCCCTGCGCCCAGATGCTCCTGTTGA
A
AAGTCACCCGAGGAGACAGCTACCCAGGTCCCCAGTCTGGAGAGTCTGACTTTAAAGCTAGAGCACGAG
GTG
GTGGCCAGGAGCCGACCAACCCCACAAGACTATGAGATGCGAGTATCCCCCTCTGATACTACCCCTC
TG
GTTTCCCGGAGTGTTCCACCAGTCAAACTGGAGGATGAGGATGATTCGGACTCTGAGCTGGACTTGAG
C
AAGCTGTCACCATCTTCTTCTTCTTCCTCATCCTCATCCAGCTCCAGCTCCAGCACTGATGAGAGTGAG
GAT
GAGAAGGAAGAGAAGCTAACTGACCAGTCCCGCTCAAAGCTCTATGATGAAGAGAGTCTCCTGTCCC
TC
ACTATGTCCCAAGATGGATTCCCAAATGAAGATGGAGAACAAATGACCCCTGAGCTTCTGCTACTGCA
G
GAAAGACAAAGAGCCTCTGAGTGGCCCAAGGATCGTGTCCTGATAAACCGTATTGACCTCGTCTGCCAG
GCT
GTACTCTCAGGGAAGTGGCCTTCTAGCCGTAGGAGCCAGGAAATGGTAACAGGAGGAATTTTGGGGC
CA
GGCAACCACTTGCTAGACAGTCCCTCATTGACTCCTGGAGAATATGGTGACTCTCCAGTCCCCACACC
A
CGAAGTAGTAGTGCAGCTTCCATGGCAGAGGAGGAAGCATCTGCAGTCAGCACAGCGGCAGCCCAGTTC
ACC
AAACTTCGCCGAGGCATGGATGAAAAGGAGTTTACAGTTCAAATCAAAGATGAGGAAGGATTGAAGT
TA
ACATTCCAGAAGCACAAGTTGATGGCGAATGGAGTAATGGGAGATGGACATCCACTGTTTCATAAGAA
G
AAGGGGAACAGAAAGAAGCTAGTAGAGCTGGAGGTGGAGTGCATGGAAGAGCCTAATCACCTTGATGTG
GAC
CTGGAGACCCGGATCCCTGTCATCAATAAGGTGGATGGTACTTTGCTGGTGGGTGAGGATGCCCCTC
GC
CGGGCTGAACTGGAGATGTGGTTACAGGGTCATCCAGAGTTTGCTGTTGATCCCCGATTTCTAGCGTA
T
ATGGAGGATCGCAGAAAACAGAAGTGGCAAAGATGTAAAAAAAATAATAAGGCAGAATTGAACTGTTTG
GGA
ATGGAACCAGTACAGACAGCTAACTCTAGAAATGGGAAAAAGGGTCATCACACTGAAACGGTGTTCA
AC
CGGGTTTTGCCAGGGCCTATTGCACCAGAGAGCAGCAAGAAGCGGGCCCGTAGGATGCGACCAGACCT
T
TCTAAGATGATGGCCCTCATGCAGGGTGGAAGCACTGGGTCTCTATCTCTGCATAACACGTTCCAACAC
AGC
AGTAGTGGCCTACAGTCTGTGTCATCTTTGGGTCACAGCAGTGCCACTTCTGCATCTTTGCCTTTTA
TG
CCATTTGTGATGGGTGGTGCACCATCATCCCCTCATGTAGACTCCAGCACCATGCTTCATCACCACCA
C
CACCACCCCCACCCCCACCATCACCACCATCACCATCCAGGCTTGAGAGCCCCTGGCTACCCCTCTTCA
CCA
GTGACTACCGCCTCTGGTACTACCTTGCGGTTGCCACCACTGCAACCTGAGGAGGATGACGATGAGG
AT
GAAGAAGATGATGATGACTTATCTCAGGGCTATGATAGCTCAGAAAGGGACTTCTCACTCATTGATGA
T
CCTATGATGCCAGCTAACTCAGACTCCAGTGAAGATGCTGATGACTGA


Translation (2302 aa):
MKGESKRITLVLQQPQSGGPQGHRHVVLGSLPGKIVLQGNQLAALTQAKNAQGQPAKVVTIQLQVQQPQQ
K
IQIVPQPPSSQPQPQQPPSTQPVTLSSVQQAQIMGPGQSPGQRLSVPVKVVLQPQ
AGSSQGASSGLSVV
K
VLSASEVAALSSPASSAPHSGGKTGMEENRRLEHQKKQEKANRIVAEAIARARARGEQNIPRVLNEDEL
P
SVRPEEEGEKKRRKKSAGERLKEEKPKKSKTSGASKTKGKSKL
NTITPVVGKKRKRNTSSDNSDVEVMP
A
QSPREDEESSIQ
KRRSNRQVKRKKYTEDLDIKITDDEEEEEVDVTGPIKPEPILPEPVQEPDGETLPSM
Q
FFV
ENPSEEDAAIVDKVLSMRIVKKELPSGQYTEAEEFFVKYKNYSYLHCEWATISQLEKDKRIHQKLK
R
FKTKMAQMRHFFHE
DEEPFNPDYVEVDRILDESHSIDKDNGEPVIYYLVKWCSLPYEDSTWELKEDVDE
G
KIREFKRIQSRHPELKRV
NRPQASAWKKLELSHEYKNRNQLREYQLEGVNWLLFNWYNRQNCILADEMG
L
GKTIQSIAFLQEVYNVGIHGPFLVIAPLSTITNWEREFNTWTEMNTIVYHGSLASRQMIQQYEMYCKDS
R
GRLIPGAYKFDALITTFEMILSDCPELREIEWRCVIIDEAHRLKNRNCKLLDSLKHMDLEHKVLLTGTP
L
QNTVEELFSLLHFLEPSQFPSESEFLKDFGDLKTEEQ
VQKLQAILKPMMLRRLKEDVEKNLAPKQETII
E
VELTNIQKKYYRAILEKNFSFLSKGAGHTNMPNLLNTMMELRKCCNHPYLIN
GAEEKILTEFREACHII
P
HDFHLQAMVRSAGKLVLIDKLLPKLKAGGHKVLIFSQMVRCLDILEDYLIQR
RYLYERIDGRVRGNLRQ
A
AIDRFSKPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQ
AQARCHRIGQSKAVKVYRLIT
R
NSYEREMFDKASLKLGLDKAVLQSMSGRDGNITG
IQQFSKKEIEDLLRKGAYAAIMEEDDEGSKFCEED
I
DQILLRRTTTITIESEGKGSTFAK
ASFVASENRTDISLDDPNFWQKWAKKADLDMDLLNSKNNLVIDTP
R
VRKQTRHFSTLKDDDLVEFSDLESEDDERPRSRRHDRHHAYGRTDCFRVEKHLLVY
GWGRWRDILSHGR
F
KRRMTERDVETICRAILVYCLLHYRGDENIKGFIWDLISPAENGKTKELQNHS
GLSIPVPRGRKGKKVK
S
QSTFDIHKADWIRKYNPDTLFQDESYKKHLKHQCN
KVLLRVRMLYYLRQEVIGDQAEKVLGGAIASEID
I
WFPVVDQLEVPTTWWDSEADKSLLIGVFKH
GYEKYNTMRADPALCFLEKAGRPDDKAIAAEHRVLDNFS
D
IVE
GVDFDKDCEDPEYKPLQGPPKDQDDEGDPLMMMDEEISVIDGDEAQVTQQPGHLFWPPGSALTARL
R
RLVTAYQRSYKREQMKIEAAERGDRRRRRCEAAFKLKEIARREKQQ
RWTRREQTDFYRVVSTFGVEYDP
D
TMQFHWDRFRTFARLDKKTDESLTKYFHGFVAMCRQVCRLPPAAGD
EPPDPNLFIEPITEERASRTLYR
I
ELLRRLREQVLCHPLLEDRLALCQPPGPELPKWWEPVRHDGELLRGAARHGVSQTDCNIMQDPDFSFLA
A
RMNYMQNHQAGAPAPSLSRCSTPLLHQQYTSRTASPLPLRPDAPVEKSPEETATQVPSLESLTLKLEHE
V
VARSRPTPQDYEMRVSPSDTTPLVSRSVPPVKLEDEDDSDSELDLSKLSPSSSSSSSSSSSSSSTDESE
D
EKEEKL
TDQSRSKLYDEESLLSLTMSQDGFPNEDGEQMTPELLLLQERQRASEWPKDRVLINRIDLVCQ
A
VLSGKWPSSRRSQEMVTGGILGPGNHLLDSPSLTPGEYGDSPVPTPRSSSAASMAEEEASAVSTAAAQF
T
KLRRGMDEKEFTVQIKD
EEGLKLTFQKHKLMANGVMGDGHPLFHKKKGNRKKLVELEVECMEEPNHLDV
D
LETRIPVINKVDGTLLVGEDAPRRAELEMWLQGHPEFAVDPRFLA
YMEDRRKQKWQRCKKNNKAELNCL
G
MEPVQTANSRNGKK
GHHTETVFNRVLPGPIAPESSKKRARRMRPDLSKMMALMQGGSTGSLSLHNTFQH
S
SSGLQSVSSLGHSSATSASLPFMPFVMGGAPSSPHVDSSTMLHHHHHHPHPHHHHHHHPGLRAPGYPSS
P
VTTASGTTLRLPPLQPEEDDDEDEEDDDDLSQGYDSSERDFSLIDDPMMPANSDSSEDADD




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser