NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS45061.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
45061.1 Public Homo sapiens 13 ABCC4 22 109 92 CCDS HistoryNCBI Gene:10257Re-query CCDS DB by CCDS ID:45061.1Re-query CCDS DB by GeneID:10257See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 45061.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000629385.1 ENSP00000487081.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000629385.1Link to Ensembl Protein Viewer:ENSP00000487081.1Re-query CCDS DB by Nucleotide ID:ENST00000629385Re-query CCDS DB by Protein ID:ENSP00000487081
Original member NCBI NM_001105515.2 NP_001098985.1 Updated not alive Link to Nucleotide Sequence:NM_001105515.2Link to Protein Sequence:NP_001098985.1Re-query CCDS DB by Nucleotide ID:NM_001105515Re-query CCDS DB by Protein ID:NP_001098985
Current member NCBI NM_001105515.3 NP_001098985.1 Accepted alive Link to Nucleotide Sequence:NM_001105515.3Link to Protein Sequence:NP_001098985.1Re-query CCDS DB by Nucleotide ID:NM_001105515Re-query CCDS DB by Protein ID:NP_001098985Link to BLAST:NP_001098985.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001098985.1 859 O15439-3 859 100% 0 0

Chromosomal Locations for CCDS 45061.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 13 (NC_000013.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 95096135 95096179 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95115922 95116001 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95161189 95161335 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95163122 95163216 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95163610 95163647 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95164378 95164518 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95166158 95166367 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95170532 95170628 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95177707 95177793 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95177997 95178091 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95186701 95186892 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95188453 95188542 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95194836 95194937 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95206532 95206781 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95207800 95207925 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95209434 95209597 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95210692 95210781 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95234610 95234834 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95246975 95247095 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95247643 95247753 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95301241 95301314 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2580 nt):
ATGCTGCCCGTGTACCAGGAGGTGAAGCCCAACCCGCTGCAGGACGCGAACCTCTGCTCACGCGTGTTCT
TC
TGGTGGCTCAATCCCTTGTTTAAAATTGGCCATAAACGGAGATTAGAGGAAGATGATATGTATTCAGT
G
CTGCCAGAAGACCGCTCACAGCACCTTGGAGAGGAGTTGCAAGGGTTCTGGGATAAAGAAGTTTTAAGA
GCT
GAGAATGACGCACAGAAGCCTTCTTTAACAAGAGCAATCATAAAGTGTTACTGGAAATCTTATTTAG
TT
TTGGGAATTTTTACGTTAATTGAGGAAAGTGCCAAAGTAATCCAGCCCATATTTTTGGGAAAAATTAT
T
AATTATTTTGAAAATTATGATCCCATGGATTCTGTGGCTTTGAACACAGCGTACGCCTATGCCACGGTG
CTG
ACTTTTTGCACGCTCATTTTGGCTATACTGCATCACTTATATTTTTATCACGTTCAGTGTGCTGGGA
TG
AGGTTACGAGTAGCCATGTGCCATATGATTTATCGGAAGGCACTTCGTCTTAGTAACATGGCCATGGG
G
AAGACAACCACAGGCCAGATAGTCAATCTGCTGTCCAATGATGTGAACAAGTTTGATCAGGTGACAGTG
TTC
TTACACTTCCTGTGGGCAGGACCACTGCAGGCGATTGCAGTGACTGCCCTACTCTGGATGGAGATAG
GA
ATATCGTGCCTTGCTGGGATGGCAGTTCTAATCATTCTCCTGCCCTTGCAAAGCTGTTTTGGGAAGTT
G
TTCTCATCACTGAGGAGTAAAACTGCAACTTTCACGGATGCCAGGATCAGGACCATGAATGAAGTTATA
ACT
GGTATAAGGATAATAAAAATGTACGCCTGGGAAAAGTCATTTTCAAATCTTATTACCAATTTGAGAA
A
G
AAGGAGATTTCCAAGATTCTGAGAAGTTCCTGCCTCAGAGGGATGAATTTGGCTTCATTTTTCAGTGC
A
AGCAAAATCATCGTGTTTGTGACCTTCACCACCTACGTGCTCCTCGGCAGTGTGATCACAGCCAGCCGC
GTG
TTCGTGGCAGTGACGCTGTATGGGGCTGTGCGGCTGACGGTTACCCTCTTCTTCCCCTCAGCCATTG
AG
AGGGTGTCAGAGGCAATCGTCAGCATCCGAAGAATCCAGACCTTTTTGCTACTTGATGAGATATCACA
G
CGCAACCGTCAGCTGCCGTCAGATGGTAAAAAGATGGTGCATGTGCAGGATTTTACTGCTTTTTGGGAT
AAG
GCATCAGAGACCCCAACTCTACAAGGCCTTTCCTTTACTGTCAGACCTGGCGAATTGTTAGCTGTGG
TC
GGCCCCGTGGGAGCAGGGAAGTCATCACTGTTAAGTGCCGTGCTCGGGGAATTGGCCCCAAGTCACGG
G
CTGGTCAGCGTGCATGGAAGAATTGCCTATGTGTCTCAGCAGCCCTGGGTGTTCTCGGGAACTCTGAGG
AGT
AATATTTTATTTGGGAAGAAATACGAAAAGGAACGATATGAAAAAGTCATAAAGGCTTGTGCTCTGA
AA
AAGGATTTACAGCTGTTGGAGGATGGTGATCTGACTGTGATAGGAGATCGGGGAACCACGCTGAGTGG
A
GGGCAGAAAGCACGGGTAAACCTTGCAAGAGCAGTGTATCAAGATGCTGACATCTATCTCCTGGACGAT
CCT
CTCAGTGCAGTAGATGCGGAAGTTAGCAGACACTTGTTCGAACTGTGTATTTGTCAAATTTTGCATG
AG
AAGATCACAATTTTAGTGACTCATCAGTTGCAGTACCTCAAAGCTGCAAGTCAGATTCTGATATTGAA
A
GATGGTAAAATGGTGCAGAAGGGGACTTACACTGAGTTCCTAAAATCTGGTATAGATTTTGGCTCCCTT
TTA
AAGAAGGATAATGAGGAAAGTGAACAACCTCCAGTTCCAGGAACTCCCACACTAAGGAATCGTACCT
TC
TCAGAGTCTTCGGTTTGGTCTCAACAATCTTCTAGACCCTCCTTGAAAGATGGTGCTCTGGAGAGCCA
A
GATACAGAGAATGTCCCAGTTACACTATCAGAGGAGAACCGTTCTGAAGGAAAAGTTGGTTTTCAGGCC
TAT
AAGAATTACTTCAGAGCTGGTGCTCACTGGATTGTCTTCATTTTCCTTATTCTCCTAAACACTGCAG
CT
CAGGTTGCCTATGTGCTTCAAGATTGGTGGCTTTCATACTGGGCAAACAAACAAAGTATGCTAAATGT
C
ACTGTAAATGGAGGAGGAAATGTAACCGAGAAGCTAGATCTTAACTGGTACTTAGGAATTTATTCAGGT
TTA
ACTGTAGCTACCGTTCTTTTTGGCATAGCAAGATCTCTATTGGTATTCTACGTCCTTGTTAACTCTT
CA
CAAACTTTGCACAACAAAATGTTTGAGTCAATTCTGAAAGCTCCGGTATTATTCTTTGATAGAAATCC
A
ATAGGAAGAATTTTAAATCGTTTCTCCAAAGACATTGGACACTTGGATGATTTGCTGCCGCTGACGTTT
TTA
GATTTCATCCAGAGATGGGATCTCGCTGTGTTGTCCTGGCTGGTCTCAAACTCCTAG


Translation (859 aa):
MLPVYQEVKPNPLQDANLCSRVFFWWLNPLFKIGHKRRLEEDDMYSVLPEDRSQHLGEELQGFWDKEVLR
A
ENDAQKPSLTRAIIKCYWKSYLVLGIFTLIE
ESAKVIQPIFLGKIINYFENYDPMDSVALNTAYAYATV
L
TFCTLILAILHHLYFYHVQCAGMRLRVAMCHMIYRK
ALRLSNMAMGKTTTGQIVNLLSNDVNKFDQVTV
F
LHFLWAGPLQAIAVTALLWMEIGISCLAGMAVLIILLPLQSCFGKLFSSL
RSKTATFTDARIRTMNEVI
T
GIRIIKMYAWEKSFSNLITNLR
KKEISKILRSSCLRGMNLASFFSASKIIVFVTFTTYVLLGSVITASR
V
FVAVTLYGAVRLTVTLFFPSAIERVSEAIVSIRRIQ
TFLLLDEISQRNRQLPSDGKKMVHVQDFTAFWD
K
ASETPTLQGLSFTVRPGELLAVVGPVGAGKSSLLSAVLGELAPSHGLVSVHGRIAYVSQQPWVFSGTLR
S
NILFGKKYEKERYEKVIKACALKK
DLQLLEDGDLTVIGDRGTTLSGGQKARVNLARAVYQDADIYLLDD
P
LSAVDAEVSRHLFE
LCICQILHEKITILVTHQLQYLKAASQILILKDGKMVQKGTYTEFLKSGIDFGSL
L
KKDNEESEQPPVPGTPTLRNRTFSESSVWSQQSSRPSLKDGALESQD
TENVPVTLSEENRSEGKVGFQA
Y
KNYFRAGAHWIVFIFLILLNTAAQ
VAYVLQDWWLSYWANKQSMLNVTVNGGGNVTEKLDLNWYLGIYSG
L
TVATVLFGIARSLLVFYVLVNSSQTLHNKMFESILKAPVLFFDRNPI
GRILNRFSKDIGHLDDLLPLTF
L
DFIQ
RWDLAVLSWLVSNS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser