NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS44865.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
44865.1 Public Homo sapiens 12 ANO6 22 109 92 CCDS HistoryNCBI Gene:196527Re-query CCDS DB by CCDS ID:44865.1Re-query CCDS DB by GeneID:196527See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 44865.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000425752.6 ENSP00000391417.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000425752.6Link to Ensembl Protein Viewer:ENSP00000391417.2Re-query CCDS DB by Nucleotide ID:ENST00000425752Re-query CCDS DB by Protein ID:ENSP00000391417
Original member Current member NCBI NM_001142679.1 NP_001136151.1 Accepted alive Link to Nucleotide Sequence:NM_001142679.1Link to Protein Sequence:NP_001136151.1Re-query CCDS DB by Nucleotide ID:NM_001142679Re-query CCDS DB by Protein ID:NP_001136151Link to BLAST:NP_001136151.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001136151.1 929 Q4KMQ2-4 929 100% 0 0

Chromosomal Locations for CCDS 44865.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 45216322 45216391 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 45302014 45302093 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 45331295 45331423 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 45347022 45347087 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 45348028 45348315 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 45348518 45348631 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 45350659 45350774 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 45357290 45357424 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 45367688 45367793 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 45378053 45378113 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 45388161 45388303 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 45390421 45390498 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 45401795 45402020 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 45403072 45403241 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 45403439 45403536 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 45409357 45409487 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 45416699 45416904 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 45421071 45421273 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 45422957 45423062 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 45439675 45439938 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2790 nt):
ATGAAAAAGATGAGCAGGAATGTTTTGCTACAAATGGAGGAGGAGGAGGACGACGACGATGGGGATATCG
TG
TTGGAAAACCTTGGACAGACAATTGTCCCCGATTTGGGATCACTGGAAAGTCAGCATGATTTTCGAAC
C
CCGGAGTTTGAAGAATTTAATGGAAAACCTGACTCCCTCTTTTTTAATGATGGCCAGCGAAGAATTGAC
TTT
GTTCTAGTATATGAGGATGAAAGCAGAAAAGAGACCAATAAAAAGGGTACAAATGAAAAACAAAGGA
GG
AAAAGACAAGCATACGAATCTAACCTTATCTGTCATGGCCTGCAGTTAGAAGCAACAAGATCAGTATT
G
GATGACAAGCTTGTATTTGTAAAAGTACACGCACCATGGGAGGTGTTATGTACGTATGCTGAGATAATG
CAC
ATCAAATTGCCTCTGAAACCCAATGATCTGAAAAACCGGTCCTCAGCCTTTGGTACACTCAACTGGT
TT
ACCAAAGTCCTCAGTGTAGACGAAAGCATCATCAAGCCAGAGCAAGAGTTTTTCACTGCCCCATTTGA
G
AAGAACCGGATGAATGATTTTTACATAGTTGATAGAGATGCTTTCTTCAATCCAGCCACCAGAAGCCGC
ATT
GTTTACTTCATCCTCTCTCGGGTCAAGTATCAAGTGATAAACAATGTTAGCAAGTTTGGGATCAACA
GA
CTTGTAAACTCTGGGATCTACAAGGCAGCTTTCCCACTCCATGATTGCAAATTCCGCCGTCAGTCAGA
G
GATCCCAGCTGCCCTAATGAACGGTACCTTCTGTACAGAGAATGGGCTCATCCTCGAAGCATATACAAA
AAG
CAGCCCTTGGATCTTATCAGGAAATACTATGGAGAGAAGATTGGAATCTACTTTGCTTGGCTGGGCT
AT
TACACTCAGATGCTTCTCCTGGCCGCAGTTGTAGGAGTGGCTTGCTTTCTCTATGGATATCTTAATCA
A
GATAACTGTACATGGAGCAAAGAAGTTTGTCATCCTGATATTGGTGGCAAGATCATAATGTGTCCTCAG
TGT
GATAGGCTTTGTCCATTCTGGAAACTCAATATTACTTGCGAGTCCTCAAAGAAATTGTGCATCTTCG
AC
AGTTTTGGAACCCTGGTCTTTGCAGTATTTATGGGAGTATGGGTTACCTTGTTTTTGGAGTTTTGGAA
G
CGACGCCAGGCAGAACTTGAGTATGAATGGGATACTGTTGAGTTACAGCAGGAAGAACAAGCCCGACCA
GAA
TACGAAGCACGATGTACTCACGTAGTGATAAATGAGATTACTCAGGAAGAAGAACGCATTCCCTTTA
CT
GCCTGGGGAAAATGTATACGGATAACCCTCTGTGCCAGTGCTGTCTTTTTCTGGATCCTATTGATCAT
C
GCTTCAGTTATTGGGATCATTGTCTATAGGCTCTCGGTGTTCATTGTATTTTCTGCAAAACTTCCCAAG
AAC
ATTAATGGAACAGACCCAATCCAGAAATACCTGACTCCACAGACAGCCACGTCCATCACGGCCTCCA
TC
ATCAGCTTTATAATTATCATGATTCTGAACACCATATATGAAAAAGTGGCAATTATGATTACTAACTT
C
GAACTCCCAAGGACCCAGACTGATTATGAGAACAGCCTCACCATGAAGATGTTCTTATTCCAGTTTGTC
AAC
TACTACTCTTCATGCTTCTACATAGCATTCTTTAAGGGCAAATTTGTAGGCTATCCAGGAGACCCAG
TT
TATTGGTTGGGAAAATACAGAAATGAAGAGTGTGACCCAGGTGGCTGTCTTCTTGAACTGACAACTCA
G
CTGACAATAATCATGGGAGGAAAAGCAATCTGGAATAACATACAAGAAGTATTATTGCCCTGGATCATG
AAT
CTAATTGGGCGATTTCACAGAGTTTCTGGATCAGAAAAGATAACCCCACGATGGGAACAGGACTACC
AT
CTGCAGCCTATGGGCAAACTGGGATTATTTTATGAATATCTTGAAATGATTATTCAGTTTGGGTTCGT
C
ACCTTATTTGTGGCCTCTTTTCCACTGGCCCCTCTGTTGGCTCTCGTGAACAATATATTGGAAATAAGA
GTG
GACGCATGGAAACTGACCACCCAGTTTAGACGCCTGGTACCAGAGAAAGCCCAAGACATTGGAGCAT
GG
CAGCCCATCATGCAAGGAATAGCAATTCTGGCTGTGGTGACCAATGCCATGATCATAGCTTTCACGTC
G
GACATGATCCCCCGCCTAGTGTACTACTGGTCCTTCTCCGTCCCTCCCTACGGGGACCACACTTCCTAC
ACC
ATGGAAGGGTACATCAACAACACTCTCTCCATCTTCAAAGTCGCAGACTTCAAAAACAAAAGCAAGG
GA
AACCCGTACTCTGACCTGGGTAACCATACCACATGCAGGTATCGTGATTTCCGATACCCACCTGGACA
C
CCCCAGGAGTATAAACACAACATCTACTATTGGCATGTGATTGCAGCCAAGCTGGCTTTTATCATTGTC
ATG
GAGTATCTCGCTTTGTTGCCCAGGCTGGGACACAGTGGCATGATCTTGGCTCACTGCAACCTCCGCC
TC
CCAGTTGACTGCTGTATGTGTTATAGGTTTGTCGATGAAATTAGACTTTTGGAACAACTAACTTCTGA
C
TTTATTGACTCCCTCTATTATATATTTTCTATTTCAATAATATCTATTTTCTTTTCTGTTACTTTCTTT
TTC
CTTCTACTTTCTTTGGGGCCAACTCCGTGTTTTTCTGTATCGAATTTCTTAAGTTAG


Translation (929 aa):
MKKMSRNVLLQMEEEEDDDDGDIVLENLGQTIVPDLGSLESQHDFRTPEFEEFNGKPDSLFFNDGQRRID
F
VLVYEDESRKETNKKGTNEKQR
RKRQAYESNLICHGLQLEATRSVLDDKLVFVKVHAPWEVLCTYAEIM
H
IKLPLKPNDLKNRSSAFGTLNWFTKVLSVDESIIKPEQEFFTAPFEKNRMNDFYIVDRDAFFNPATRSR
I
VYFILSRVKYQVINNVSKFGINRLVNSGIYKAAFPLHDCKFRRQSEDPSCPNERYLLYREWAHPRSIYK
K
QPLDLI
RKYYGEKIGIYFAWLGYYTQMLLLAAVVGVACFLYGYLNQDNCTWSKEVCHPDIGGKIIMCPQ
C
DRLCPFWKLNITCESSK
KLCIFDSFGTLVFAVFMGVWVTLFLEFWKRRQAELEYEWDTVELQQEEQARP
E
YEARCTHVVINEITQ
EEERIPFTAWGKCIRITLCASAVFFWILLIIASVIGIIVYRLSVFIVFSAKLPK
N
INGTDPIQKYLTPQTATSITASIISFIIIMILNTIYEKVAIMITNF
ELPRTQTDYENSLTMKMFLFQFV
N
YYSSCFYIAFFKGKFVGYPGDPVYWLGKYRNEE
CDPGGCLLELTTQLTIIMGGKAIWNNIQEVLLPWIM
N
LIGRFHRVSGSEKITPRWEQDYHLQPMGKLGLFYEYLEM
IIQFGFVTLFVASFPLAPLLALVNNILEIR
V
DAWKLTTQFRRLVPEKAQDIGAWQPIMQGIAILAVVTN
AMIIAFTSDMIPRLVYYWSFSVPPYGDHTSY
T
MEGYINNTLSIFKVADFKNKSKGNPYSDLGNHTTC
RYRDFRYPPGHPQEYKHNIYYWHVIAAKLAFIIV
M
E
YLALLPRLGHSGMILAHCNLRLPVDCCMCYRFVDEIRLLEQLTSDFIDSLYYIFSISIISIFFSVTFF
F
LLLSLGPTPCFSVSNFLS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser