NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS44626.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
44626.1 Public Homo sapiens 11 EEF1G 22 109 92 CCDS HistoryNCBI Gene:1937Re-query CCDS DB by CCDS ID:44626.1Re-query CCDS DB by GeneID:1937See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 44626.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000329251.4 ENSP00000331901.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000329251.4Link to Ensembl Protein Viewer:ENSP00000331901.4Re-query CCDS DB by Nucleotide ID:ENST00000329251Re-query CCDS DB by Protein ID:ENSP00000331901
Original member Current member NCBI NM_001404.4 NP_001395.1 Accepted alive Link to Nucleotide Sequence:NM_001404.4Link to Protein Sequence:NP_001395.1Re-query CCDS DB by Nucleotide ID:NM_001404Re-query CCDS DB by Protein ID:NP_001395Link to BLAST:NP_001395.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001395.1 437 P26641-1 437 100% 0 0

Chromosomal Locations for CCDS 44626.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 62559679 62559837 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 62560069 62560193 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 62560282 62560454 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 62566806 62567010 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 62567399 62567528 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 62570965 62571108 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 62571540 62571682 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 62571838 62571901 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 62572584 62572742 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 62573831 62573842 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1314 nt):
ATGGCGGCTGGGACCCTGTACACGTATCCTGAAAACTGGAGGGCCTTCAAGGCTCTCATCGCTGCTCAGT
AC
AGCGGGGCTCAGGTCCGCGTGCTCTCCGCACCACCCCACTTCCATTTTGGCCAAACCAACCGCACCCC
T
GAATTTCTCCGCAAATTTCCTGCCGGCAAGGTCCCAGCATTTGAGGGTGATGATGGATTCTGTGTGTTT
GAG
AGCAACGCCATTGCCTACTATGTGAGCAATGAGGAGCTGCGGGGAAGTACTCCAGAGGCAGCAGCCC
AG
GTGGTGCAGTGGGTGAGCTTTGCTGATTCCGATATAGTGCCCCCAGCCAGTACCTGGGTGTTCCCCAC
C
TTGGGCATCATGCACCACAACAAACAGGCCACTGAGAATGCAAAGGAGGAAGTGAGGCGAATTCTGGGG
CTG
CTGGATGCTTACTTGAAGACGAGGACTTTTCTGGTGGGCGAACGAGTGACATTGGCTGACATCACAG
TT
GTCTGCACCCTGTTGTGGCTCTATAAGCAGGTTCTAGAGCCTTCTTTCCGCCAGGCCTTTCCCAATAC
C
AACCGCTGGTTCCTCACCTGCATTAACCAGCCCCAGTTCCGGGCTGTCTTGGGCGAAGTGAAACTGTGT
GAG
AAGATGGCCCAGTTTGATGCTAAAAAGTTTGCAGAGACCCAACCTAAAAAGGACACACCACGGAAAG
AG
AAGGGTTCACGGGAAGAGAAGCAGAAGCCCCAGGCTGAGCGGAAGGAGGAGAAAAAGGCGGCTGCCCC
T
GCTCCTGAGGAGGAGATGGATGAATGTGAGCAGGCGCTGGCTGCTGAGCCCAAGGCCAAGGACCCCTTC
GCT
CACCTGCCCAAGAGTACCTTTGTGTTGGATGAATTTAAGCGCAAGTACTCCAATGAGGACACACTCT
CT
GTGGCACTGCCATATTTCTGGGAGCACTTTGATAAGGACGGCTGGTCCCTGTGGTACTCAGAGTATCG
C
TTCCCTGAAGAACTCACTCAGACCTTCATGAGCTGCAATCTCATCACTGGAATGTTCCAGCGACTGGAC
AAG
CTGAGGAAGAATGCCTTCGCCAGTGTCATCCTTTTTGGAACCAACAATAGCAGCTCCATTTCTGGAG
TC
TGGGTCTTCCGAGGCCAGGAGCTTGCCTTTCCGCTGAGTCCAGATTGGCAGGTGGACTACGAGTCATA
C
ACATGGCGGAAACTGGATCCTGGCAGCGAGGAGACCCAGACGCTGGTTCGAGAGTACTTTTCCTGGGAG
GGG
GCCTTCCAGCATGTGGGCAAAGCCTTCAATCAGGGCAAGATCTTCAAGTGA


Translation (437 aa):
MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPAFEGDDGFCVF
E
SNAIAYY
VSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNKQATENAKEEVRRILG
L
LDAYLKTRTFLVGERVTLADITVVCTLLWLYKQ
VLEPSFRQAFPNTNRWFLTCINQPQFRAVLGEVKLC
E
KMAQFD
AKKFAETQPKKDTPRKEKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPF
A
HLPK
STFVLDEFKRKYSNEDTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLD
K
LRKNAFASVILFGTNNSSSISGVWVFRGQELAFP
LSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWE
G
AFQHVGKAFNQGKIFK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser