NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS44309.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
44309.1 Public Homo sapiens 1 CR1 22 109 92 CCDS HistoryNCBI Gene:1378Re-query CCDS DB by CCDS ID:44309.1Re-query CCDS DB by GeneID:1378See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)


Attributes
CDS uses downstream AUG

Sequence IDs included in CCDS 44309.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000400960.7 ENSP00000383744.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000400960.7Link to Ensembl Protein Viewer:ENSP00000383744.2Re-query CCDS DB by Nucleotide ID:ENST00000400960Re-query CCDS DB by Protein ID:ENSP00000383744
Original member NCBI NM_000573.3 NP_000564.2 Updated not alive Link to Nucleotide Sequence:NM_000573.3Link to Protein Sequence:NP_000564.2Re-query CCDS DB by Nucleotide ID:NM_000573Re-query CCDS DB by Protein ID:NP_000564
Current member NCBI NM_000573.4 NP_000564.2 Accepted alive Link to Nucleotide Sequence:NM_000573.4Link to Protein Sequence:NP_000564.2Re-query CCDS DB by Nucleotide ID:NM_000573Re-query CCDS DB by Protein ID:NP_000564Link to BLAST:NP_000564.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000564.2 2039 P17927 2039 99.951% 0 1

Chromosomal Locations for CCDS 44309.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 207496268 207496388 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 207505904 207506083 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 207506714 207506813 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 207511569 207511654 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 207523611 207524009 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 207526753 207526929 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 207527021 207527123 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 207528716 207528801 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 207532180 207532398 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 207533409 207533588 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 207534197 207534296 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 207539981 207540066 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 207542182 207542580 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 207563864 207564040 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 207564132 207564234 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 207565838 207565923 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 207567824 207568042 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 207569059 207569238 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 207569847 207569946 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 207575595 207575680 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 207577805 207578203 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 207580240 207580416 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 207580511 207580613 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 207581918 207582003 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 207584649 207584876 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 207587386 207587565 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 207588675 207588774 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 207607251 207607336 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 207609290 207609688 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 207611677 207611853 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 207611939 207612041 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 207614404 207614489 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 207616575 207616802 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 207618071 207618247 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 207619880 207620065 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 207621973 207621996 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 207622993 207623068 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 207630517 207630621 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 207639397 207639409 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (6120 nt):
ATGGGGGCCTCTTCTCCAAGAAGCCCGGAGCCTGTCGGGCCGCCGGCGCCCGGTCTCCCCTTCTGCTGCG
GA
GGATCCCTGCTGGCGGTTGTGGTGCTGCTTGCGCTGCCGGTGGCCTGGGGTCAATGCAATGCCCCAGA
A
TGGCTTCCATTTGCCAGGCCTACCAACCTAACTGATGAATTTGAGTTTCCCATTGGGACATATCTGAAC
TAT
GAATGCCGCCCTGGTTATTCCGGAAGACCGTTTTCTATCATCTGCCTAAAAAACTCAGTCTGGACTG
GT
GCTAAGGACAGGTGCAGACGTAAATCATGTCGTAATCCTCCAGATCCTGTGAATGGCATGGTGCATGT
G
ATCAAAGGCATCCAGTTCGGATCCCAAATTAAATATTCTTGTACTAAAGGATACCGACTCATTGGTTCC
TCG
TCTGCCACATGCATCATCTCAGGTGATACTGTCATTTGGGATAATGAAACACCTATTTGTGACAGAA
TT
CCTTGTGGGCTACCCCCCACCATCACCAATGGAGATTTCATTAGCACCAACAGAGAGAATTTTCACTA
T
GGATCAGTGGTGACCTACCGCTGCAATCCTGGAAGCGGAGGGAGAAAGGTGTTTGAGCTTGTGGGTGAG
CCC
TCCATATACTGCACCAGCAATGACGATCAAGTGGGCATCTGGAGCGGCCCCGCCCCTCAGTGCATTA
TA
CCTAACAAATGCACGCCTCCAAATGTGGAAAATGGAATATTGGTATCTGACAACAGAAGCTTATTTTC
C
TTAAATGAAGTTGTGGAGTTTAGGTGTCAGCCTGGCTTTGTCATGAAAGGACCCCGCCGTGTGAAGTGC
CAG
GCCCTGAACAAATGGGAGCCGGAGCTACCAAGCTGCTCCAGGGTATGTCAGCCACCTCCAGATGTCC
TG
CATGCTGAGCGTACCCAAAGGGACAAGGACAACTTTTCACCTGGGCAGGAAGTGTTCTACAGCTGTGA
G
CCCGGCTACGACCTCAGAGGGGCTGCGTCTATGCGCTGCACACCCCAGGGAGACTGGAGCCCTGCAGCC
CCC
ACATGTGAAGTGAAATCCTGTGATGACTTCATGGGCCAACTTCTTAATGGCCGTGTGCTATTTCCAG
TA
AATCTCCAGCTTGGAGCAAAAGTGGATTTTGTTTGTGATGAAGGATTTCAATTAAAAGGCAGCTCTGC
T
AGTTACTGTGTCTTGGCTGGAATGGAAAGCCTTTGGAATAGCAGTGTTCCAGTGTGTGAACAAATCTTT
TGT
CCAAGTCCTCCAGTTATTCCTAATGGGAGACACACAGGAAAACCTCTGGAAGTCTTTCCCTTTGGGA
AA
ACAGTAAATTACACATGCGACCCCCACCCAGACAGAGGGACGAGCTTCGACCTCATTGGAGAGAGCAC
C
ATCCGCTGCACAAGTGACCCTCAAGGGAATGGGGTTTGGAGCAGCCCTGCCCCTCGCTGTGGAATTCTG
G
GT
CACTGTCAAGCCCCAGATCATTTTCTGTTTGCCAAGTTGAAAACCCAAACCAATGCATCTGACTTTC
CC
ATTGGGACATCTTTAAAGTACGAATGCCGTCCTGAGTACTACGGGAGGCCATTCTCTATCACATGTCT
A
GATAACCTGGTCTGGTCAAGTCCCAAAGATGTCTGTAAACGTAAATCATGTAAAACTCCTCCAGATCCA
GTG
AATGGCATGGTGCATGTGATCACAGACATCCAGGTTGGATCCAGAATCAACTATTCTTGTACTACAG
G
G
CACCGACTCATTGGTCACTCATCTGCTGAATGTATCCTCTCGGGCAATGCTGCCCATTGGAGCACGAA
G
CCGCCAATTTGTCAACGAATTCCTTGTGGGCTACCCCCCACCATCGCCAATGGAGATTTCATTAGCACC
AAC
AGAGAGAATTTTCACTATGGATCAGTGGTGACCTACCGCTGCAATCCTGGAAGCGGAGGGAGAAAGG
TG
TTTGAGCTTGTGGGTGAGCCCTCCATATACTGCACCAGCAATGACGATCAAGTGGGCATCTGGAGCGG
C
CCGGCCCCTCAGTGCATTATACCTAACAAATGCACGCCTCCAAATGTGGAAAATGGAATATTGGTATCT
GAC
AACAGAAGCTTATTTTCCTTAAATGAAGTTGTGGAGTTTAGGTGTCAGCCTGGCTTTGTCATGAAAG
GA
CCCCGCCGTGTGAAGTGCCAGGCCCTGAACAAATGGGAGCCGGAGCTACCAAGCTGCTCCAGGGTATG
T
CAGCCACCTCCAGATGTCCTGCATGCTGAGCGTACCCAAAGGGACAAGGACAACTTTTCACCCGGGCAG
GAA
GTGTTCTACAGCTGTGAGCCCGGCTATGACCTCAGAGGGGCTGCGTCTATGCGCTGCACACCCCAGG
GA
GACTGGAGCCCTGCAGCCCCCACATGTGAAGTGAAATCCTGTGATGACTTCATGGGCCAACTTCTTAA
T
GGCCGTGTGCTATTTCCAGTAAATCTCCAGCTTGGAGCAAAAGTGGATTTTGTTTGTGATGAAGGATTT
CAA
TTAAAAGGCAGCTCTGCTAGTTATTGTGTCTTGGCTGGAATGGAAAGCCTTTGGAATAGCAGTGTTC
CA
GTGTGTGAACAAATCTTTTGTCCAAGTCCTCCAGTTATTCCTAATGGGAGACACACAGGAAAACCTCT
G
GAAGTCTTTCCCTTTGGAAAAGCAGTAAATTACACATGCGACCCCCACCCAGACAGAGGGACGAGCTTC
GAC
CTCATTGGAGAGAGCACCATCCGCTGCACAAGTGACCCTCAAGGGAATGGGGTTTGGAGCAGCCCTG
CC
CCTCGCTGTGGAATTCTGGGTCACTGTCAAGCCCCAGATCATTTTCTGTTTGCCAAGTTGAAAACCCA
A
ACCAATGCATCTGACTTTCCCATTGGGACATCTTTAAAGTACGAATGCCGTCCTGAGTACTACGGGAGG
CCA
TTCTCTATCACATGTCTAGATAACCTGGTCTGGTCAAGTCCCAAAGATGTCTGTAAACGTAAATCAT
GT
AAAACTCCTCCAGATCCAGTGAATGGCATGGTGCATGTGATCACAGACATCCAGGTTGGATCCAGAAT
C
AACTATTCTTGTACTACAGGGCACCGACTCATTGGTCACTCATCTGCTGAATGTATCCTCTCAGGCAAT
ACT
GCCCATTGGAGCACGAAGCCGCCAATTTGTCAACGAATTCCTTGTGGGCTACCCCCAACCATCGCCA
AT
GGAGATTTCATTAGCACCAACAGAGAGAATTTTCACTATGGATCAGTGGTGACCTACCGCTGCAATCT
T
GGAAGCAGAGGGAGAAAGGTGTTTGAGCTTGTGGGTGAGCCCTCCATATACTGCACCAGCAATGACGAT
CAA
GTGGGCATCTGGAGCGGCCCCGCCCCTCAGTGCATTATACCTAACAAATGCACGCCTCCAAATGTGG
AA
AATGGAATATTGGTATCTGACAACAGAAGCTTATTTTCCTTAAATGAAGTTGTGGAGTTTAGGTGTCA
G
CCTGGCTTTGTCATGAAAGGACCCCGCCGTGTGAAGTGCCAGGCCCTGAACAAATGGGAGCCAGAGTTA
CCA
AGCTGCTCCAGGGTGTGTCAGCCGCCTCCAGAAATCCTGCATGGTGAGCATACCCCAAGCCATCAGG
AC
AACTTTTCACCTGGGCAGGAAGTGTTCTACAGCTGTGAGCCTGGCTATGACCTCAGAGGGGCTGCGTC
T
CTGCACTGCACACCCCAGGGAGACTGGAGCCCTGAAGCCCCGAGATGTGCAGTGAAATCCTGTGATGAC
TTC
TTGGGTCAACTCCCTCATGGCCGTGTGCTATTTCCACTTAATCTCCAGCTTGGGGCAAAGGTGTCCT
TT
GTCTGTGATGAAGGGTTTCGCTTAAAGGGCAGTTCCGTTAGTCATTGTGTCTTGGTTGGAATGAGAAG
C
CTTTGGAATAACAGTGTTCCTGTGTGTGAACATATCTTTTGTCCAAATCCTCCAGCTATCCTTAATGGG
AGA
CACACAGGAACTCCCTCTGGAGATATTCCCTATGGAAAAGAAATATCTTACACATGTGACCCCCACC
CA
GACAGAGGGATGACCTTCAACCTCATTGGGGAGAGCACCATCCGCTGCACAAGTGACCCTCATGGGAA
T
GGGGTTTGGAGCAGCCCTGCCCCTCGCTGTGAACTTTCTGTTCGTGCTGGTCACTGTAAAACCCCAGAG
CAG
TTTCCATTTGCCAGTCCTACGATCCCAATTAATGACTTTGAGTTTCCAGTCGGGACATCTTTGAATT
AT
GAATGCCGTCCTGGGTATTTTGGGAAAATGTTCTCTATCTCCTGCCTAGAAAACTTGGTCTGGTCAAG
T
GTTGAAGACAACTGTAGACGAAAATCATGTGGACCTCCACCAGAACCCTTCAATGGAATGGTGCATATA
AAC
ACAGATACACAGTTTGGATCAACAGTTAATTATTCTTGTAATGAAGGGTTTCGACTCATTGGTTCCC
CA
TCTACTACTTGTCTCGTCTCAGGCAATAATGTCACATGGGATAAGAAGGCACCTATTTGTGAGATCAT
A
TCTTGTGAGCCACCTCCAACCATATCCAATGGAGACTTCTACAGCAACAATAGAACATCTTTTCACAAT
GGA
ACGGTGGTAACTTACCAGTGCCACACTGGACCAGATGGAGAACAGCTGTTTGAGCTTGTGGGAGAAC
GG
TCAATATATTGCACCAGCAAAGATGATCAAGTTGGTGTTTGGAGCAGCCCTCCCCCTCGGTGTATTTC
T
ACTAATAAATGCACAGCTCCAGAAGTTGAAAATGCAATTAGAGTACCAGGAAACAGGAGTTTCTTTACC
CTC
ACTGAGATCATCAGATTTAGATGTCAGCCCGGGTTTGTCATGGTAGGGTCCCACACTGTGCAGTGCC
AG
ACCAATGGCAGATGGGGGCCCAAGCTGCCACACTGCTCCAGGGTGTGTCAGCCGCCTCCAGAAATCCT
G
CATGGTGAGCATACCCTAAGCCATCAGGACAACTTTTCACCTGGGCAGGAAGTGTTCTACAGCTGTGAG
CCC
AGCTATGACCTCAGAGGGGCTGCGTCTCTGCACTGCACGCCCCAGGGAGACTGGAGCCCTGAAGCCC
CT
AGATGTACAGTGAAATCCTGTGATGACTTCCTGGGCCAACTCCCTCATGGCCGTGTGCTACTTCCACT
T
AATCTCCAGCTTGGGGCAAAGGTGTCCTTTGTTTGCGATGAAGGGTTCCGATTAAAAGGCAGGTCTGCT
AGT
CATTGTGTCTTGGCTGGAATGAAAGCCCTTTGGAATAGCAGTGTTCCAGTGTGTGAACAAATCTTTT
GT
CCAAATCCTCCAGCTATCCTTAATGGGAGACACACAGGAACTCCCTTTGGAGATATTCCCTATGGAAA
A
GAAATATCTTACGCATGCGACACCCACCCAGACAGAGGGATGACCTTCAACCTCATTGGGGAGAGCTCC
ATC
CGCTGCACAAGTGACCCTCAAGGGAATGGGGTTTGGAGCAGCCCTGCCCCTCGCTGTGAACTTTCTG
TT
CCTGCTGCCTGCCCACATCCACCCAAGATCCAAAACGGGCATTACATTGGAGGACACGTATCTCTATA
T
CTTCCTGGGATGACAATCAGCTACATTTGTGACCCCGGCTACCTGTTAGTGGGAAAGGGCTTCATTTTC
TGT
ACAGACCAGGGAATCTGGAGCCAATTGGATCATTATTGCAAAGAAGTAAATTGTAGCTTCCCACTGT
TT
ATGAATGGAATCTCGAAGGAGTTAGAAATGAAAAAAGTATATCACTATGGAGATTATGTGACTTTGAA
G
TGTGAAGATGGGTATACTCTGGAAGGCAGTCCCTGGAGCCAGTGCCAGGCGGATGACAGATGGGACCCT
CCT
CTGGCCAAATGTACCTCTCGTACACATGATGCTCTCATAGTTGGCACTTTATCTGGTACGATCTTCT
TT
ATTTTACTCATCATTTTCCTCTCTTGGATAATTCTAAAGCACAGAAAAGGCAATAATGCACATGAAAA
C
CCTAAAGAAGTGGCTATCCATTTACATTCTCAAGGAGGCAGCAGCGTTCATCCCCGAACTCTGCAAACA
AAT
GAAGAAAATAGCAGGGTCCTTCCTTGA


Translation (2039 aa):
MGASSPRSPEPVGPPAPGLPFCCGGSLLAVVVLLALPVAWGQCNAPEWLPFARPTNLTDEFEFPIGTYLN
Y
ECRPGYSGRPFSIICLKNSVWTGAKDRCR
RKSCRNPPDPVNGMVHVIKGIQFGSQIKYSCTKGYRLIGS
S
SATCIISGDTVIWDNETPICD
RIPCGLPPTITNGDFISTNRENFHYGSVVTYRCNPGSGGRKVFELVGE
P
SIYCTSNDDQVGIWSGPAPQCIIPNKCTPPNVENGILVSDNRSLFSLNEVVEFRCQPGFVMKGPRRVKC
Q
ALNKWEPELPSCSR
VCQPPPDVLHAERTQRDKDNFSPGQEVFYSCEPGYDLRGAASMRCTPQGDWSPAA
P
TCE
VKSCDDFMGQLLNGRVLFPVNLQLGAKVDFVCDEGFQLKGSSASYCVLAGMESLWNSSVPVCEQIF
C
PSPPVIPNGRHTGKPLEVFPFGKTVNYTCDPHPDRGTSFDLIGESTIRCTSDPQGNGVWSSPAPRCGIL

G
HCQAPDHFLFAKLKTQTNASDFPIGTSLKYECRPEYYGRPFSITCLDNLVWSSPKDVCKRKSCKTPPDP
V
NGMVHVITDIQVGSRINYSCTT
GHRLIGHSSAECILSGNAAHWSTKPPICQRIPCGLPPTIANGDFIST
N
RENFHYGSVVTYRCNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCIIPNKCTPPNVENGILVS
D
NRSLFSLNEVVEFRCQPGFVMKGPRRVKCQALNKWEPELPSCSR
VCQPPPDVLHAERTQRDKDNFSPGQ
E
VFYSCEPGYDLRGAASMRCTPQGDWSPAAPTCE
VKSCDDFMGQLLNGRVLFPVNLQLGAKVDFVCDEGF
Q
LKGSSASYCVLAGMESLWNSSVPVCE
QIFCPSPPVIPNGRHTGKPLEVFPFGKAVNYTCDPHPDRGTSF
D
LIGESTIRCTSDPQGNGVWSSPAPRCGIL
GHCQAPDHFLFAKLKTQTNASDFPIGTSLKYECRPEYYGR
P
FSITCLDNLVWSSPKDVCK
RKSCKTPPDPVNGMVHVITDIQVGSRINYSCTTGHRLIGHSSAECILSGN
T
AHWSTKPPICQ
RIPCGLPPTIANGDFISTNRENFHYGSVVTYRCNLGSRGRKVFELVGEPSIYCTSNDD
Q
VGIWSGPAPQCIIPNKCTPPNVENGILVSDNRSLFSLNEVVEFRCQPGFVMKGPRRVKCQALNKWEPEL
P
SCSR
VCQPPPEILHGEHTPSHQDNFSPGQEVFYSCEPGYDLRGAASLHCTPQGDWSPEAPRCAVKSCDD
F
LGQLPHGRVLFPLNLQLGAKVSFVCDE
GFRLKGSSVSHCVLVGMRSLWNNSVPVCEHIFCPNPPAILNG
R
HTGTPSGDIPYGKEISYTCDPHPDRGMTFNLIGESTIRCTSDPHGNGVWSSPAPRCELSVRA
GHCKTPE
Q
FPFASPTIPINDFEFPVGTSLNYECRPGYFGKMFSISCLENLVWSSVEDNCR
RKSCGPPPEPFNGMVHI
N
TDTQFGSTVNYSCNE
GFRLIGSPSTTCLVSGNNVTWDKKAPICEIISCEPPPTISNGDFYSNNRTSFHN
G
TVVTYQCHTGPDGEQLFELVGERSIYCTSKDDQVGVWSSPPPRCISTNKCTAPEVENAIRVPGNRSFFT
L
TEIIRFRCQPGFVMVGSHTVQCQTNGRWGPKLPHCSR
VCQPPPEILHGEHTLSHQDNFSPGQEVFYSCE
P
SYDLRGAASLHCTPQGDWSPEAPRCT
VKSCDDFLGQLPHGRVLLPLNLQLGAKVSFVCDEGFRLKGRSA
S
HCVLAGMKALWNSSVPVCE
QIFCPNPPAILNGRHTGTPFGDIPYGKEISYACDTHPDRGMTFNLIGESS
I
RCTSDPQGNGVWSSPAPRCELSVPA
ACPHPPKIQNGHYIGGHVSLYLPGMTISYICDPGYLLVGKGFIF
C
TDQGIWSQLDHYCK
EVNCSFPLFMNGISKELEMKKVYHYGDYVTLKCEDGYTLEGSPWSQCQADDRWDP
P
LAKCTS
RTHDALIVGTLSGTIFFILLIIFLSWIILKHRKGNNAHENPKEVAIHLHSQGGSSVHPRTLQT
N
EENS
RVLP



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser