NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, June 25, 2024, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS43970.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
43970.1 Public Homo sapiens X MED12 24 110 108 CCDS HistoryNCBI Gene:9968Re-query CCDS DB by CCDS ID:43970.1Re-query CCDS DB by GeneID:9968See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 5, NCBI annotation release 36.3, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 43970.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000374080.8 ENSP00000363193.3 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000374080.8Link to Ensembl Protein Viewer:ENSP00000363193.3Re-query CCDS DB by Nucleotide ID:ENST00000374080Re-query CCDS DB by Protein ID:ENSP00000363193
Original member Current member NCBI NM_005120.3 NP_005111.2 MANE Select Accepted alive Link to Nucleotide Sequence:NM_005120.3Link to Protein Sequence:NP_005111.2Re-query CCDS DB by Nucleotide ID:NM_005120Re-query CCDS DB by Protein ID:NP_005111Link to BLAST:NP_005111.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_005111.2 2177 Q93074-1 2177 100% 0 0

Chromosomal Locations for CCDS 43970.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome X (NC_000023.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 71118755 71118853 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71119373 71119477 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71119686 71119877 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71120014 71120170 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71120971 71121152 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71121327 71121437 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71121562 71121816 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71122200 71122346 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71122508 71122607 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71122738 71122874 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71123095 71123226 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71123594 71123720 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71124159 71124388 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71124764 71124844 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71124976 71125146 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71125351 71125495 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71125663 71125713 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71126036 71126154 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71126341 71126484 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71126969 71127132 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71127336 71127467 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71127893 71128120 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71128296 71128440 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71128598 71128718 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71129114 71129215 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71129316 71129429 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71129680 71129855 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71130035 71130214 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71131550 71131621 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71132073 71132206 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71132377 71132538 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71132845 71132956 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71133123 71133212 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71134357 71134466 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71134713 71134848 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71135092 71135253 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71136281 71136655 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71136879 71137029 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71137187 71137383 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71137558 71137635 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71137726 71137943 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71140635 71140857 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71141230 71141370 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71141883 71141964 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 71142175 71142218 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (6534 nt):
ATGGCGGCCTTCGGGATCTTGAGCTACGAACACCGGCCCCTGAAGCGGCCGCGGCTGGGGCCTCCCGATG
TT
TACCCTCAGGACCCCAAACAGAAGGAGGATGAACTGACGGCCTTGAATGTAAAACAAGGTTTCAATAA
C
CAGCCTGCTGTCTCTGGGGATGAGCATGGCAGTGCCAAGAACGTCAGCTTCAATCCTGCCAAGATCAGT
TCC
AACTTCAGCAGCATTATTGCAGAGAAATTACGTTGTAATACCCTTCCTGACACTGGTCGCAGGAAGC
CC
CAAGTGAACCAGAAGGATAACTTCTGGCTGGTGACTGCACGATCCCAGAGTGCCATTAACACTTGGTT
C
ACTGACTTGGCTGGCACCAAGCCACTCACGCAACTAGCCAAAAAGGTCCCCATTTTCAGTAAGAAGGAA
GAG
GTGTTTGGGTACTTAGCCAAATACACAGTGCCTGTGATGCGGGCTGCCTGGCTCATTAAGATGACCT
GT
GCCTACTATGCAGCAATCTCTGAGACCAAGGTTAAGAAGAGACATGTTGACCCTTTCATGGAATGGAC
T
CAGATCATCACCAAGTACTTATGGGAGCAGTTACAGAAGATGGCTGAATACTACCGGCCAGGGCCTGCA
GGA
AGTGGGGGCTGTGGTTCCACGATAGGGCCCTTGCCCCATGATGTAGAGGTGGCAATCCGGCAGTGGG
AT
TACACCGAGAAGCTGGCCATGTTCATGTTTCAGGATGGAATGCTGGACAGACATGAGTTCCTGACCTG
G
GTGCTTGAGTGTTTTGAGAAGATCCGCCCTGGAGAGGATGAATTGCTTAAACTGCTGCTGCCTCTGCTT
CTC
CGATACTCTGGGGAATTTGTTCAGTCTGCATACCTGTCCCGCCGGCTTGCCTACTTCTGTACACGGA
GA
CTGGCCCTGCAGCTGGATGGTGTGAGCAGTCACTCATCTCATGTTATATCTGCTCAGTCAACAAGCAC
G
CTACCCACCACCCCTGCTCCTCAGCCCCCAACTAGCAGCACACCCTCGACTCCCTTTAGTGACCTGCTT
ATG
TGCCCTCAGCACCGGCCCCTGGTTTTTGGCCTCAGCTGTATCCTACAGACCATCCTCCTGTGCTGTC
CT
AGTGCCTTGGTTTGGCACTACTCACTGACTGATAGCAGAATTAAGACCGGCTCACCACTTGACCACTT
G
CCTATTGCCCCGTCCAACCTGCCCATGCCAGAGGGTAACAGTGCCTTCACTCAGCAGGTCCGTGCAAAG
TTG
CGGGAGATCGAGCAGCAGATCAAGGAGCGGGGACAGGCAGTTGAAGTTCGCTGGTCTTTCGATAAAT
GC
CAGGAAGCTACTGCAGGCTTCACCATTGGACGGGTACTTCATACTTTGGAAGTGCTGGACAGCCATAG
T
TTTGAACGCTCTGACTTCAGCAACTCTCTTGACTCCCTTTGTAACCGAATCTTTGGATTGGGACCTAGC
AAG
GATGGGCATGAGATCTCCTCAGATGATGATGCTGTGGTGTCATTGCTATGTGAATGGGCTGTCAGCT
GC
AAGCGTTCTGGTCGGCATCGTGCTATGGTGGTAGCCAAGCTCCTGGAGAAGAGACAGGCGGAGATTGA
G
GCTGAGCGTTGTGGAGAATCAGAAGCCGCAGATGAGAAGGGTTCCATCGCCTCTGGCTCCCTTTCTGCT
CCC
AGTGCTCCCATTTTCCAGGATGTCCTCCTGCAGTTTCTGGATACACAGGCTCCCATGCTGACGGACC
CT
CGAAGTGAGAGTGAGCGGGTGGAATTCTTTAACTTAGTACTGCTGTTCTGTGAACTGATTCGACATGA
T
GTTTTCTCCCACAACATGTATACTTGCACTCTCATCTCCCGAGGGGACCTTGCCTTTGGAGCCCCTGGT
CCC
CGGCCTCCCTCTCCCTTTGATGATCCTGCCGATGACCCAGAGCACAAGGAGGCTGAAGGCAGCAGCA
GC
AGCAAGCTGGAAGATCCAGGGCTCTCAGAATCTATGGACATTGACCCTAGTTCCAGTGTTCTCTTTGA
G
GACATGGAGAAGCCTGATTTCTCATTGTTCTCCCCTACTATGCCCTGTGAGGGGAAGGGCAGTCCATCC
CCT
GAGAAGCCAGATGTCGAGAAGGAGGTGAAGCCCCCACCCAAGGAGAAGATTGAAGGGACCCTTGGGG
TT
CTTTACGACCAGCCACGACACGTGCAGTACGCCACCCATTTTCCCATCCCCCAGGAGGAGTCATGCAG
C
CATGAGTGCAACCAGCGGTTGGTCGTACTGTTTGGGGTGGGAAAGCAGCGAGATGATGCCCGCCATGCC
ATC
AAGAAAATCACCAAGGATATCTTGAAGGTTCTGAACCGCAAAGGGACAGCAGAAACTGACCAGCTTG
CT
CCTATTGTGCCTCTGAATCCTGGAGACCTGACATTCTTAGGTGGGGAGGATGGGCAGAAGCGGCGACG
C
AACCGGCCTGAAGCCTTCCCCACTGCTGAAGATATCTTTGCTAAGTTCCAGCACCTTTCACATTATGAC
CAA
CACCAGGTCACGGCTCAGGTCTCCCGGAATGTTCTGGAGCAGATCACGAGCTTTGCCCTTGGCATGT
CA
TACCACTTGCCTCTGGTGCAGCATGTGCAGTTCATCTTCGACCTCATGGAATATTCACTCAGCATCAG
T
GGCCTCATCGACTTTGCCATTCAGCTGCTGAATGAACTGAGTGTAGTTGAGGCTGAGCTGCTTCTCAAA
TCC
TCGGATCTGGTGGGCAGCTACACTACTAGCCTGTGCCTGTGCATCGTGGCTGTCCTGCGGCACTATC
AT
GCCTGCCTCATCCTCAACCAGGACCAGATGGCACAGGTCTTTGAGGGGCTGTGTGGCGTCGTGAAGCA
T
GGGATGAACCGGTCCGATGGCTCCTCTGCAGAGCGCTGTATCCTTGCTTATCTCTATGATCTGTACACC
TCC
TGTAGCCATTTAAAGAACAAATTTGGGGAGCTCTTCAGCGACTTTTGCTCAAAGGTGAAGAACACCA
TC
TACTGCAACGTGGAGCCATCGGAATCAAATATGCGCTGGGCACCTGAGTTCATGATCGACACTCTAGA
G
AACCCTGCAGCTCACACCTTCACCTACACGGGGCTAGGCAAGAGTCTTAGTGAGAACCCTGCTAACCGC
TAC
AGCTTTGTCTGCAATGCCCTTATGCACGTCTGTGTGGGGCACCATGATCCCGATAGGGTGAATGACA
TC
GCAATCCTGTGTGCAGAGCTGACCGGCTATTGCAAGTCACTGAGTGCAGAATGGCTAGGAGTGCTTAA
G
GCCTTGTGCTGCTCCTCTAACAATGGCACTTGTGGTTTCAACGATCTCCTCTGCAATGTTGATGTCAGT
GAC
CTATCTTTTCATGACTCGCTGGCTACTTTTGTTGCCATCCTCATCGCTCGGCAGTGTTTGCTCCTGG
AA
GATCTGATTCGCTGTGCTGCCATCCCTTCACTCCTTAATGCTGCTTGTAGTGAACAGGACTCTGAGCC
A
GGGGCCCGGCTTACCTGCCGCATCCTCCTTCACCTTTTCAAGACACCGCAGCTCAATCCTTGCCAGTCT
GAT
GGAAACAAGCCTACAGTAGGAATCCGCTCCTCCTGCGACCGCCACCTGCTGGCTGCCTCCCAGAACC
GC
ATCGTGGATGGAGCCGTGTTTGCTGTTCTCAAGGCTGTGTTTGTACTTGGGGATGCGGAACTGAAAGG
T
TCAGGCTTCACTGTGACAGGAGGAACAGAAGAACTTCCAGAGGAGGAGGGAGGAGGTGGCAGTGGTGGT
CGG
AGGCAGGGTGGCCGCAACATCTCTGTGGAGACAGCCAGTCTGGATGTCTATGCCAAGTACGTGCTGC
GC
AGCATCTGCCAACAGGAATGGGTAGGAGAACGTTGCCTTAAGTCTCTGTGTGAGGACAGCAATGACCT
G
CAAGACCCAGTGTTGAGTAGTGCCCAGGCGCAGCGCCTCATGCAGCTCATTTGCTATCCACATCGACTG
CTG
GACAATGAGGATGGGGAAAACCCCCAGCGGCAGCGCATAAAGCGCATTCTCCAGAACTTGGACCAGT
GG
ACCATGCGCCAGTCTTCCTTGGAGCTGCAGCTCATGATCAAGCAGACCCCTAACAATGAGATGAACTC
C
CTCTTGGAGAACATCGCCAAGGCCACAATCGAGGTTTTCCAACAGTCAGCAGAGACAGGGTCATCTTCT
GGA
AGTACTGCAAGCAACATGCCCAGCAGCAGCAAGACCAAGCCTGTGCTCAGCTCTCTAGAGCGCTCTG
GT
GTATGGCTGGTGGCCCCCCTCATTGCTAAACTGCCCACCTCAGTCCAGGGACATGTGTTAAAGGCTGC
T
GGGGAAGAATTGGAGAAGGGTCAGCACCTGGGTTCCTCTTCACGCAAAGAACGTGATCGACAAAAGCAG
AAG
AGCATGTCCCTATTGAGCCAGCAGCCCTTCTTATCGCTGGTGCTAACATGTCTGAAAGGGCAGGATG
AA
CAACGCGAGGGACTCCTTACCTCCCTCTACAGCCAGGTGCACCAGATTGTGAATAATTGGCGAGATGA
C
CAGTACTTAGATGATTGCAAACCAAAGCAGCTTATGCATGAGGCACTCAAACTGCGGCTCAACCTGGTG
GGG
GGCATGTTTGACACGGTGCAGCGCAGCACCCAGCAGACCACGGAGTGGGCCATGCTCCTCCTGGAGA
TC
ATCATCAGCGGCACTGTCGACATGCAGTCCAACAATGAGCTCTTCACTACTGTGTTGGACATGCTGAG
C
GTGCTCATCAATGGGACATTGGCTGCAGACATGTCTAGCATCTCGCAAGGTAGCATGGAGGAAAACAAG
CGT
GCATACATGAACCTGGCGAAGAAGTTGCAGAAGGAGTTGGGGGAGCGCCAGTCAGACAGTCTGGAAA
AG
GTTCGCCAGCTGCTGCCACTGCCCAAGCAGACCCGAGATGTCATCACGTGTGAGCCACAGGGCTCCCT
T
ATCGATACCAAGGGCAACAAGATTGCTGGCTTCGATTCCATCTTCAAGAAGGAGGGTCTACAGGTTTCC
ACC
AAACAGAAGATCTCGCCCTGGGATCTTTTTGAGGGGTTGAAGCCGTCAGCACCACTCTCTTGGGGCT
GG
TTTGGAACAGTCCGAGTGGACCGGCGAGTGGCTCGAGGAGAGGAGCAGCAGCGGTTGCTGCTCTACCA
C
ACACACCTGAGGCCCCGGCCCCGCGCCTATTACCTGGAGCCACTGCCACTGCCCCCAGAAGATGAGGAG
CCG
CCTGCTCCTACCCTGCTAGAGCCTGAGAAAAAGGCTCCAGAGCCCCCCAAAACTGACAAACCGGGGG
CT
GCTCCACCCAGTACTGAGGAACGCAAGAAGAAGTCCACCAAGGGCAAGAAACGCAGCCAGCCAGCTAC
C
AAGACAGAGGACTATGGAATGGGCCCGGGTCGGAGCGGCCCTTATGGTGTGACAGTGCCTCCGGACCTC
CTG
CACCACCCAAACCCTGGTTCTATAACACACCTTAACTACAGGCAAGGCTCCATAGGCCTGTACACCC
AG
AACCAGCCACTACCTGCAGGTGGCCCTCGTGTGGACCCATACCGTCCTGTGCGCTTACCAATGCAGAA
G
CTGCCCACCCGACCAACTTACCCTGGAGTGCTGCCCACAACCATGACTGGCGTCATGGGTTTAGAACCC
TCC
TCTTATAAGACCTCTGTGTACCGGCAGCAGCAACCTGCGGTGCCCCAAGGACAGCGCCTTCGCCAAC
AG
CTCCAGCAGAGTCAGGGCATGTTGGGACAGTCATCTGTCCATCAGATGACTCCCAGCTCTTCCTACGG
T
TTGCAGACTTCCCAGGGCTATACTCCTTATGTTTCTCATGTGGGATTGCAGCAACACACAGGCCCTGCA
GGT
ACCATGGTGCCCCCCAGCTACTCCAGCCAGCCTTACCAGAGCACCCACCCTTCTACCAATCCTACTC
TT
GTAGATCCTACCCGCCACCTGCAACAGCGGCCCAGTGGCTATGTGCACCAGCAGGCCCCCACCTATGG
A
CATGGACTGACCTCCACTCAAAGGTTTTCACACCAGACACTGCAGCAGACACCCATGATAAGTACCATG
ACT
CCAATGAGTGCCCAGGGCGTCCAGGCAGGCGTCCGTTCAACAGCCATCCTACCTGAGCAGCAGCAGC
AG
CAGCAACAGCAGCAACAGCAACAGCAGCAGCAGCAGCAACAGCAACAGCAGCAGCAGCAGCAGCAGTA
C
CACATCCGGCAGCAGCAGCAGCAGCAGATCCTGCGGCAGCAGCAGCAACAGCAACAGCAGCAGCAGCAG
CAG
CAGCAACAGCAACAGCAGCAGCAGCAACAGCAACAACAGCAACACCAGCAGCAACAGCAGCAACAGG
CG
GCTCCTCCCCAACCCCAGCCCCAGTCCCAGCCCCAGTTCCAGCGCCAGGGGCTTCAGCAGACCCAGCA
G
CAGCAACAGACAGCAGCTTTGGTCCGGCAACTTCAACAACAGCTCTCTAATACCCAGCCACAGCCCAGT
ACC
AACATATTTGGACGCTACTGA


Translation (2177 aa):
MAAFGILSYEHRPLKRPRLGPPDVYPQDPKQKEDELTALNVKQGFNNQPAVSGDEHGSAKNVSFNPAKIS
S
NFSSIIAEKLRCNTLPDTGRRKPQVNQKDNFWLVTARSQSAINTWFTDLAGTKPLTQLAKK
VPIFSKKE
E
VFGYLAKYTVPVMRAAWLIKMTCAYYAAISETKVKKRHVDPFM
EWTQIITKYLWEQLQKMAEYYRPGPA
G
SGGCGSTIGPLPHDVEVAIRQWDYTEKLAMFMFQ
DGMLDRHEFLTWVLECFEKIRPGEDELLKLLLPLL
L
R
YSGEFVQSAYLSRRLAYFCTRRLALQLDGVSSHSSHVISAQSTSTLPTTPAPQPPTSSTPSTPFSDLL
M
CPQHRPLVFGLSCILQ
TILLCCPSALVWHYSLTDSRIKTGSPLDHLPIAPSNLPMPEGNSAFTQQVRAK
L
REIEQQIKERGQAVEVRWSFDKCQEATA
GFTIGRVLHTLEVLDSHSFERSDFSNSLDSLCNRIFGLGPS
K
DGHE
ISSDDDAVVSLLCEWAVSCKRSGRHRAMVVAKLLEKRQAEIEAERCGESEAADEKGSIASGSLSA
P
SAPIFQDVLLQFLDTQAPML
TDPRSESERVEFFNLVLLFCELIRHDVFSHNMYTCTLISRGDLAFGAPG
P
RPPSPFDDPADDPEHKEAEGSSSSKLE
DPGLSESMDIDPSSSVLFEDMEKPDFSLFSPTMPCEGKGSPS
P
EKPDVEKEVKPPPKEKIEGTLGVLYDQPRHVQYATHFPIPQ
EESCSHECNQRLVVLFGVGKQRDDARHA
I
KKITKDILKVLNRKGTAET
DQLAPIVPLNPGDLTFLGGEDGQKRRRNRPEAFPTAEDIFAKFQHLSHYD
Q
HQVTAQ
VSRNVLEQITSFALGMSYHLPLVQHVQFIFDLMEYSLSISGLIDFAIQLLNELSVVEAELLLK
S
SDLVGSYTTSLCLCIVAVLRHYHACLILNQDQMAQVFE
GLCGVVKHGMNRSDGSSAERCILAYLYDLYT
S
CSHLKNKFGELF
SDFCSKVKNTIYCNVEPSESNMRWAPEFMIDTLENPAAHTFTYTGLGKSLSENPANR
Y
SFVCNALMHVCVGHHDPD
RVNDIAILCAELTGYCKSLSAEWLGVLKALCCSSNNGTCGFNDLLCNVDVS
D
LSFHDSLATFVAILIARQCLLLEDLIRCAAIPSLLNA
ACSEQDSEPGARLTCRILLHLFKTPQLNPCQS
D
G
NKPTVGIRSSCDRHLLAASQNRIVDGAVFAVLKAVFVLGDAELKGSGFTVTGGTEELPEEEGGGGSGG
R
RQGGRNISVETASLDVYAKYVLRSICQQ
EWVGERCLKSLCEDSNDLQDPVLSSAQAQRLMQLICYPHRL
L
DNEDGENPQRQRIKRILQ
NLDQWTMRQSSLELQLMIKQTPNNEMNSLLENIAKATIEVFQQSAETGSSS
G
STASNMPSSSKTKPVL
SSLERSGVWLVAPLIAKLPTSVQGHVLKAAGEELEKGQHLGSSSRKERDRQKQ
K
SMSLLSQQPFLSLVLTCLKGQDEQREGLLTSLYSQVHQIVNNWRDDQYLDDCKPKQLMHEALKLRLNLV
G
GMFDTVQRSTQQTTEWAMLLLEIIISGTVDMQSN
NELFTTVLDMLSVLINGTLAADMSSISQGSMEENK
R
AYMNLAKKLQ
KELGERQSDSLEKVRQLLPLPKQTRDVITCEPQGSLIDTKGNKIAGFDSIFKKEGLQVS
T
KQKISPWDLFEGLKPSAPLSWGWFGTVRVDRRVARGEEQQRLLLYHTHLRPRPRAYYLEPLPLPPEDEE
P
PAPTLLEPEKKAPEPPKTDKPGAAPPSTEERKKKSTKGKKRSQPATKTE
DYGMGPGRSGPYGVTVPPDL
L
HHPNPGSITHLNYRQGSIGLYTQNQPLPA
GGPRVDPYRPVRLPMQKLPTRPTYPGVLPTTMTGVMGLEP
S
SYKTSVYRQQQPAVPQGQRLRQQLQ
QSQGMLGQSSVHQMTPSSSYGLQTSQGYTPYVSHVGLQQHTGPA
G
TMVPPSYSSQPYQSTHPSTNPTLVDPTRHLQQRPSGYVHQQAPTYGHGLTSTQ
RFSHQTLQQTPMISTM
T
PMSAQGVQAGVRSTAILPEQQQQQQQQQQQQQQQQQQQQQQQQQQYHIRQQQQQQILR
QQQQQQQQQQQ
Q
QQQQQQQQQQQQQQHQQQQQQQAAPPQPQPQSQPQ
FQRQGLQQTQQQQQTAALVRQLQQQLSNTQPQPS
T
NIFGRY




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser