NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS43785.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
43785.2 Public Homo sapiens 9 SPATA6L 22 109 92 CCDS HistoryNCBI Gene:55064Re-query CCDS DB by CCDS ID:43785.2Re-query CCDS DB by GeneID:55064See the combined annotation on chromosome 9 in Sequence Viewer

Public Note for CCDS 43785.1
The coding region has been updated to represent an alternative splicing pattern that is more supported by the available transcript data. The update is supported by the mRNA AK295831.1, whereas the CDS of the previous representation was supported by BC034293.1, but that mRNA contains alternative 3' exon structure and would be subject to nonsense-mediated mRNA decay (NMD).

Public since: CCDS release 5, NCBI annotation release 36.3, Ensembl annotation release 47

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 43785.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000475086.5 ENSP00000417063.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000475086.5Link to Ensembl Protein Viewer:ENSP00000417063.1Re-query CCDS DB by Nucleotide ID:ENST00000475086Re-query CCDS DB by Protein ID:ENSP00000417063
Original member NCBI NM_001039395.3 NP_001034484.3 Updated not alive Link to Nucleotide Sequence:NM_001039395.3Link to Protein Sequence:NP_001034484.3Re-query CCDS DB by Nucleotide ID:NM_001039395Re-query CCDS DB by Protein ID:NP_001034484
Current member NCBI NM_001039395.4 NP_001034484.3 Accepted alive Link to Nucleotide Sequence:NM_001039395.4Link to Protein Sequence:NP_001034484.3Re-query CCDS DB by Nucleotide ID:NM_001039395Re-query CCDS DB by Protein ID:NP_001034484Link to BLAST:NP_001034484.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001034484.3 334 Q8N4H0-3 334 100% 0 0

Chromosomal Locations for CCDS 43785.2

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 9 (NC_000009.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 4604180 4604269 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 4605347 4605440 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 4617923 4618110 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 4618864 4618898 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 4622408 4622510 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 4625327 4625566 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 4629091 4629168 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 4661899 4662036 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 4666212 4666250 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1005 nt):
ATGCCTCTGGAGGTGGTGGTGGAGCTGCAGATCCGGGCGATTTCTTGCCCAGGAGTGTTCCTGCCTGGCA
AA
CAAGATGTGTACCTCGGGGTCTACCTCATGAATCAGTACCTGGAGACCAACAGCTTTCCCTCTGCGTT
C
CCCATTATGATTCAGGAGAGCATGAGATTTGAAAAGGGCATTGCTCCCAAAATAGAGTTTTCTACAAGG
ACA
GCCATCAGAGAATGTGTGTTTCTGCATAGAAACAGATTTCTTGAAGAAAGACATGAGTCACGGAGGC
CT
TTATCTACATCACATGAACCAATATTTCCCTTAAATACTATAAAGATGAAACTAAAGGAGAATAATCT
C
AACAGACTGCCCAAAGGCATGCAAGCCCGGGCGCCCTCTCAATATTCTACCAGGCATTTCTTCCAGGAC
CAG
CCAGCTCAGTTGAACCTTGGAAATAATTTCAAAATCTCTGGAGGAAGCAAGCCTCCATTTGTTGTTA
GA
CACGTGGACAGTGCAAAGCCCTTTGGTGAGAATATTTCAGAGCATCATTTGAGGAGGTCTAGAAGAAA
A
TCTAAGTTTTCAGACTTTCCGTTTCCAACGAGAAGAGCTTCTTCTCTTGACAGCCTTGCAGCTAACGTA
AAG
GTTATCAAAGAGCCAGATGAACGGATTGTTTTAAGGAGTGACTCATCATCATGTTTAGATTCAAGTC
AG
TTTGGAAAGTCTTCATCCAGTAAACAAGGGGATGCTGATTTCCACGGGAAAGCTTCATTTGCCACCTA
C
CAGCATTCCACCTCTCCTGGCCCCTTGGATCAGCCCCTTCTCAGAGAAAGGTTCCATCCTGGTTCTCAG
TCC
ACATGGAAGAATATCCATGAGAGGGTATGCAGTCTTCTGACATCCCACAGAGCACAGCTGCACCAAA
AC
AAGGAAGATTCTACCTCTGAAGTAAATTATATCATTGAAAGACCAAGCTACCCTCTGAAGAAATACTC
A
CTGCATGAACAGAGATATTTTTAA


Translation (334 aa):
MPLEVVVELQIRAISCPGVFLPGKQDVYLGVYLMNQYLETNSFPSAFPIMIQESMRFEKGIAPKIEFSTR
T
AIRECVFLHRNRFL
EERHESRRPLSTSHEPIFPLNTIKMKLKENNLNRLPKGMQARAPSQYSTRHFFQD
Q
PAQLNLGNNFKISGGSKPPFVVRH
VDSAKPFGENISEHHLRRSRRKSKFSDFPFPTRRASSLDSLAANV
K
VIKEPDERIVLRSDSSSCLDSSQFGKSSSSKQGDADFHGKASFATYQHSTSPGPLDQPLLRERFHPGSQ
S
TWKNIHERVCSLLTSHRAQLHQNK
EDSTSEVNYIIERPSYPLKKYSLHEQRYF



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser