NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS43467.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
43467.2 Public Homo sapiens 6 RUNX2 22 109 92 CCDS HistoryNCBI Gene:860Re-query CCDS DB by CCDS ID:43467.2Re-query CCDS DB by GeneID:860See the combined annotation on chromosome 6 in Sequence Viewer

Public Note for CCDS 43467.1
The coding region has been updated to shorten the N-terminus to one that is more supported by the available conservation and publication data. The start codon selected in the previous representation occurred very close to the transcription start/cap site, and is therefore unlikely to be used by the ribosome.

Public since: CCDS release 5, NCBI annotation release 36.3, Ensembl annotation release 47

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)


Attributes
CDS uses downstream AUG
Inferred exon combination

Sequence IDs included in CCDS 43467.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000371438.5 ENSP00000360493.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000371438.5Link to Ensembl Protein Viewer:ENSP00000360493.1Re-query CCDS DB by Nucleotide ID:ENST00000371438Re-query CCDS DB by Protein ID:ENSP00000360493
Original member Current member EBI,WTSI ENST00000465038.6 ENSP00000420707.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000465038.6Link to Ensembl Protein Viewer:ENSP00000420707.2Re-query CCDS DB by Nucleotide ID:ENST00000465038Re-query CCDS DB by Protein ID:ENSP00000420707
Original member Current member EBI,WTSI ENST00000647337.1 ENSP00000495497.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000647337.1Link to Ensembl Protein Viewer:ENSP00000495497.1Re-query CCDS DB by Nucleotide ID:ENST00000647337Re-query CCDS DB by Protein ID:ENSP00000495497
Original member Current member NCBI NM_001024630.3 NP_001019801.3 Accepted alive Link to Nucleotide Sequence:NM_001024630.3Link to Protein Sequence:NP_001019801.3Re-query CCDS DB by Nucleotide ID:NM_001024630Re-query CCDS DB by Protein ID:NP_001019801Link to BLAST:NP_001019801.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001019801.3 521 Q13950-1 521 100% 0 0

Chromosomal Locations for CCDS 43467.2

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 6 (NC_000006.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 45328727 45328784 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 45422593 45422957 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 45431863 45432019 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 45437947 45438051 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 45491941 45492114 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 45512246 45512407 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 45545217 45545282 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 45546827 45547305 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1566 nt):
ATGGCATCAAACAGCCTCTTCAGCACAGTGACACCATGTCAGCAAAACTTCTTTTGGGATCCGAGCACCA
GC
CGGCGCTTCAGCCCCCCCTCCAGCAGCCTGCAGCCCGGCAAAATGAGCGACGTGAGCCCGGTGGTGGC
T
GCGCAACAGCAGCAGCAACAGCAGCAGCAGCAACAGCAGCAGCAGCAGCAGCAACAGCAGCAGCAGCAG
CAG
GAGGCGGCGGCGGCGGCTGCGGCGGCGGCGGCGGCTGCGGCGGCGGCAGCTGCAGTGCCCCGGTTGC
GG
CCGCCCCACGACAACCGCACCATGGTGGAGATCATCGCCGACCACCCGGCCGAACTCGTCCGCACCGA
C
AGCCCCAACTTCCTGTGCTCGGTGCTGCCCTCGCACTGGCGCTGCAACAAGACCCTGCCCGTGGCCTTC
AAG
GTGGTAGCCCTCGGAGAGGTACCAGATGGGACTGTGGTTACTGTCATGGCGGGTAACGATGAAAATT
AT
TCTGCTGAGCTCCGGAATGCCTCTGCTGTTATGAAAAACCAAGTAGCAAGGTTCAACGATCTGAGATT
T
GTGGGCCGGAGTGGACGAGGCAAGAGTTTCACCTTGACCATAACCGTCTTCACAAATCCTCCCCAAGTA
GCT
ACCTATCACAGAGCAATTAAAGTTACAGTAGATGGACCTCGGGAACCCAGAAGGCACAGACAGAAGC
TT
GATGACTCTAAACCTAGTTTGTTCTCTGACCGCCTCAGTGATTTAGGGCGCATTCCTCATCCCAGTAT
G
AGAGTAGGTGTCCCGCCTCAGAACCCACGGCCCTCCCTGAACTCTGCACCAAGTCCTTTTAATCCACAA
GGA
CAGAGTCAGATTACAGACCCCAGGCAGGCACAGTCTTCCCCGCCGTGGTCCTATGACCAGTCTTACC
CC
TCCTACCTGAGCCAGATGACGTCCCCGTCCATCCACTCTACCACCCCGCTGTCTTCCACACGGGGCAC
T
GGGCTTCCTGCCATCACCGATGTGCCTAGGCGCATTTCAGATGATGACACTGCCACCTCTGACTTCTGC
CTC
TGGCCTTCCACTCTCAGTAAGAAGAGCCAGGCAGGTGCTTCAGAACTGGGCCCTTTTTCAGACCCCA
GG
CAGTTCCCAAGCATTTCATCCCTCACTGAGAGCCGCTTCTCCAACCCACGAATGCACTATCCAGCCAC
C
TTTACTTACACCCCGCCAGTCACCTCAGGCATGTCCCTCGGTATGTCCGCCACCACTCACTACCACACC
TAC
CTGCCACCACCCTACCCCGGCTCTTCCCAAAGCCAGAGTGGACCCTTCCAGACCAGCAGCACTCCAT
AT
CTCTACTATGGCACTTCGTCAGGATCCTATCAGTTTCCCATGGTGCCGGGGGGAGACCGGTCTCCTTC
C
AGAATGCTTCCGCCATGCACCACCACCTCGAATGGCAGCACGCTATTAAATCCAAATTTGCCTAACCAG
AAT
GATGGTGTTGACGCTGATGGAAGCCACAGCAGTTCCCCAACTGTTTTGAATTCTAGTGGCAGAATGG
AT
GAATCTGTTTGGCGACCATATTGA


Translation (521 aa):
MASNSLFSTVTPCQQNFFWDPSTSRRFSPPSSSLQPGKMSDVSPVVAAQQQQQQQQQQQQQQQQQQQQQQ
Q
EAAAAAAAAAAAAAAAAAVPRLRPPHDNRTMVEIIADHPAELVRTDSPNFLCSVLPSHWRCNKTLPVAF
K
VVALGEVPDGTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQV
A
TYHRAIKVTVDGPREPR
RHRQKLDDSKPSLFSDRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFNPQ
G
QSQIT
DPRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFC
L
WPSTLSKKSQA
GASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMSATTHYHT
Y
LPPPYPGSSQSQSGPFQTSSTPYLYYGTSSGSYQFPMVPGGDRSPSRMLPPCTTTSNGSTLLNPNLPNQ
N
DGVDADGSHSSSPTVLNSSGRMDESVWRPY




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser