NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS4336.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
4336.1 Public Homo sapiens 5 ITK 22 109 92 CCDS HistoryNCBI Gene:3702Re-query CCDS DB by CCDS ID:4336.1Re-query CCDS DB by GeneID:3702See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 4336.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000422843.7 ENSP00000398655.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000422843.7Link to Ensembl Protein Viewer:ENSP00000398655.3Re-query CCDS DB by Nucleotide ID:ENST00000422843Re-query CCDS DB by Protein ID:ENSP00000398655
Original member Current member NCBI NM_005546.3 NP_005537.3 Accepted alive Link to Nucleotide Sequence:NM_005546.3Link to Protein Sequence:NP_005537.3Re-query CCDS DB by Nucleotide ID:NM_005546Re-query CCDS DB by Protein ID:NP_005537Link to BLAST:NP_005537.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_005537.3 620 Q08881 620 100% 0 0

Chromosomal Locations for CCDS 4336.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 5 (NC_000005.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 157180978 157181115 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 157208889 157208993 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 157211287 157211368 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 157214191 157214319 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 157217867 157217907 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 157222863 157223014 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 157228296 157228361 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 157232340 157232394 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 157238109 157238191 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 157240062 157240195 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 157241646 157241720 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 157243623 157243794 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 157244262 157244478 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 157245726 157245790 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 157245881 157245999 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 157248850 157249007 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 157252607 157252678 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1863 nt):
ATGAACAACTTTATCCTCCTGGAAGAACAGCTCATCAAGAAATCCCAACAAAAGAGAAGAACTTCTCCCT
CG
AACTTTAAAGTCCGCTTCTTTGTGTTAACCAAAGCCAGCCTGGCATACTTTGAAGATCGTCATGGGAA
G
AAGCGCACGCTGAAGGGGTCCATTGAGCTCTCCCGAATCAAATGTGTTGAGATTGTGAAAAGTGACATC
AGC
ATCCCATGCCACTATAAATACCCGTTTCAGGTGGTGCATGACAACTACCTCCTATATGTGTTTGCTC
CA
GATCGTGAGAGCCGGCAGCGCTGGGTGCTGGCCCTTAAAGAAGAAACGAGGAATAATAACAGTTTGGT
G
CCTAAATATCATCCTAATTTCTGGATGGATGGGAAGTGGAGGTGCTGTTCTCAGCTGGAGAAGCTTGCA
ACA
GGCTGTGCCCAATATGATCCAACCAAGAATGCTTCAAAGAAGCCTCTTCCTCCTACTCCTGAAGACA
AC
AGGCGACCACTTTGGGAACCTGAAGAAACTGTGGTCATTGCCTTATATGACTACCAAACCAATGATCC
T
CAGGAACTCGCACTGCGGCGCAACGAAGAGTACTGCCTGCTGGACAGTTCTGAGATTCACTGGTGGAGA
GTC
CAGGACAGGAATGGGCATGAAGGATATGTACCAAGCAGTTATCTGGTGGAAAAATCTCCAAATAATC
TG
GAAACCTATGAGTGGTACAATAAGAGTATCAGCCGAGACAAAGCTGAAAAACTTCTTTTGGACACAGG
C
AAAGAAGGAGCCTTCATGGTAAGGGATTCCAGGACTGCAGGAACATACACCGTGTCTGTTTTCACCAAG
GCT
GTTGTAAGTGAGAACAATCCCTGTATAAAGCATTATCACATCAAGGAAACAAATGACAATCCTAAGC
GA
TACTATGTGGCTGAAAAGTATGTGTTCGATTCCATCCCTCTTCTCATCAACTATCACCAACATAATGG
A
GGAGGCCTGGTGACTCGACTCCGGTATCCAGTTTGTTTTGGGAGGCAGAAAGCCCCAGTTACAGCAGGG
CTG
AGATACGGGAAATGGGTGATCGACCCCTCAGAGCTCACTTTTGTGCAAGAGATTGGCAGTGGGCAAT
TT
GGGTTGGTGCATCTGGGCTACTGGCTCAACAAGGACAAGGTGGCTATCAAAACCATTCGGGAAGGGGC
T
ATGTCAGAAGAGGACTTCATAGAGGAGGCTGAAGTAATGATGAAACTCTCTCATCCCAAACTGGTGCAG
CTG
TATGGGGTGTGCCTGGAGCAGGCCCCCATCTGCCTGGTGTTTGAGTTCATGGAGCACGGCTGCCTGT
CA
GATTATCTACGCACCCAGCGGGGACTTTTTGCTGCAGAGACCCTGCTGGGCATGTGTCTGGATGTGTG
T
GAGGGCATGGCCTACCTGGAAGAGGCATGTGTCATCCACAGAGACTTGGCTGCCAGAAATTGTTTGGTG
GGA
GAAAACCAAGTCATCAAGGTGTCTGACTTTGGGATGACAAGGTTCGTTCTGGATGATCAGTACACCA
GT
TCCACAGGCACCAAATTCCCGGTGAAGTGGGCATCCCCAGAGGTTTTCTCTTTCAGTCGCTATAGCAG
C
AAGTCCGATGTGTGGTCATTTGGTGTGCTGATGTGGGAAGTTTTCAGTGAAGGCAAAATCCCGTATGAA
AAC
CGAAGCAACTCAGAGGTGGTGGAAGACATCAGTACCGGATTTCGGTTGTACAAGCCCCGGCTGGCCT
CC
ACACACGTCTACCAGATTATGAATCACTGCTGGAAAGAGAGACCAGAAGATCGGCCAGCCTTCTCCAG
A
CTGCTGCGTCAACTGGCTGAAATTGCAGAATCAGGACTTTAG


Translation (620 aa):
MNNFILLEEQLIKKSQQKRRTSPSNFKVRFFVLTKASLAYFEDRHGKKRTLKGSIELSRIKCVEIVKSDI
S
IPCHYKYPFQ
VVHDNYLLYVFAPDRESRQRWVLALKEETRNNNSLVPKYHPNFWMDGKWRCCSQLEKLA
T
GCAQYDPTKN
ASKKPLPPTPEDNRRPLWEPEETVVIALYDYQTNDPQELALRRNEEYCLLDSSEIHWWR
V
QDRN
GHEGYVPSSYLVEKSPNNLETYEWYNKSISRDKAEKLLLDTGKEGAFMVRDSRTAGTYTVSVFTK
A
VV
SENNPCIKHYHIKETNDNPKRYYVAEKYVFDSIPLLINYHQHNGGGLVTRLRYPVCFGRQKAPVTAG
L
RY
GKWVIDPSELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIREGAMSEEDFIEEAEVMMKLSHPKLVQ
L
YGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEACVIHRDL
AARNCLV
G
ENQVIKVSDFGMT
RFVLDDQYTSSTGTKFPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYE
N
RSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKE
RPEDRPAFSRLLRQLAEIAESGL



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser