NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS43247.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
43247.1 Public Homo sapiens 4 MAPK10 22 109 92 CCDS HistoryNCBI Gene:5602Re-query CCDS DB by CCDS ID:43247.1Re-query CCDS DB by GeneID:5602See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 5, NCBI annotation release 36.3, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 43247.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000395157.9 ENSP00000378586.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000395157.9Link to Ensembl Protein Viewer:ENSP00000378586.4Re-query CCDS DB by Nucleotide ID:ENST00000395157Re-query CCDS DB by Protein ID:ENSP00000378586
Original member Current member EBI ENST00000640858.1 ENSP00000491122.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000640858.1Link to Ensembl Protein Viewer:ENSP00000491122.1Re-query CCDS DB by Nucleotide ID:ENST00000640858Re-query CCDS DB by Protein ID:ENSP00000491122
Original member Current member EBI ENST00000639234.1 ENSP00000491306.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000639234.1Link to Ensembl Protein Viewer:ENSP00000491306.1Re-query CCDS DB by Nucleotide ID:ENST00000639234Re-query CCDS DB by Protein ID:ENSP00000491306
Original member Current member EBI ENST00000640970.1 ENSP00000492231.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000640970.1Link to Ensembl Protein Viewer:ENSP00000492231.1Re-query CCDS DB by Nucleotide ID:ENST00000640970Re-query CCDS DB by Protein ID:ENSP00000492231
Original member Current member EBI ENST00000641274.1 ENSP00000492929.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000641274.1Link to Ensembl Protein Viewer:ENSP00000492929.1Re-query CCDS DB by Nucleotide ID:ENST00000641274Re-query CCDS DB by Protein ID:ENSP00000492929
Original member Current member EBI ENST00000642038.1 ENSP00000492942.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000642038.1Link to Ensembl Protein Viewer:ENSP00000492942.1Re-query CCDS DB by Nucleotide ID:ENST00000642038Re-query CCDS DB by Protein ID:ENSP00000492942
Original member Current member EBI ENST00000641410.1 ENSP00000493208.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000641410.1Link to Ensembl Protein Viewer:ENSP00000493208.1Re-query CCDS DB by Nucleotide ID:ENST00000641410Re-query CCDS DB by Protein ID:ENSP00000493208
Original member Current member EBI ENST00000641170.1 ENSP00000493237.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000641170.1Link to Ensembl Protein Viewer:ENSP00000493237.1Re-query CCDS DB by Nucleotide ID:ENST00000641170Re-query CCDS DB by Protein ID:ENSP00000493237
Original member Current member EBI ENST00000641050.1 ENSP00000493270.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000641050.1Link to Ensembl Protein Viewer:ENSP00000493270.1Re-query CCDS DB by Nucleotide ID:ENST00000641050Re-query CCDS DB by Protein ID:ENSP00000493270
Original member Current member EBI ENST00000641862.1 ENSP00000493396.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000641862.1Link to Ensembl Protein Viewer:ENSP00000493396.1Re-query CCDS DB by Nucleotide ID:ENST00000641862Re-query CCDS DB by Protein ID:ENSP00000493396
Original member NCBI NM_002753.4 NP_002744.1 Updated not alive Link to Nucleotide Sequence:NM_002753.4Link to Protein Sequence:NP_002744.1Re-query CCDS DB by Nucleotide ID:NM_002753Re-query CCDS DB by Protein ID:NP_002744
NCBI NM_002753.5 NP_002744.1 Updated not alive Link to Nucleotide Sequence:NM_002753.5Link to Protein Sequence:NP_002744.1Re-query CCDS DB by Nucleotide ID:NM_002753Re-query CCDS DB by Protein ID:NP_002744
Current member NCBI NM_002753.6 NP_002744.1 Accepted alive Link to Nucleotide Sequence:NM_002753.6Link to Protein Sequence:NP_002744.1Re-query CCDS DB by Nucleotide ID:NM_002753Re-query CCDS DB by Protein ID:NP_002744Link to BLAST:NP_002744.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_002744.1 422 P53779-2 422 100% 0 0

Chromosomal Locations for CCDS 43247.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 4 (NC_000004.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 86017359 86017375 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 86029197 86029274 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 86031368 86031431 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 86064266 86064390 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 86067773 86067955 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 86098524 86098595 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 86101052 86101217 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 86101894 86102032 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 86103186 86103244 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 86107223 86107352 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 86159298 86159467 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 86194336 86194401 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1269 nt):
ATGAGCCTCCATTTCTTATACTACTGCAGTGAACCAACATTGGATGTGAAAATTGCCTTTTGTCAGGGAT
TC
GATAAACAAGTGGATGTGTCATATATTGCCAAACATTACAACATGAGCAAAAGCAAAGTTGACAACCA
G
TTCTACAGTGTGGAAGTGGGAGACTCAACCTTCACAGTTCTCAAGCGCTACCAGAATCTAAAGCCTATT
GGC
TCTGGGGCTCAGGGCATAGTTTGTGCCGCGTATGATGCTGTCCTTGACAGAAATGTGGCCATTAAGA
AG
CTCAGCAGACCCTTTCAGAACCAAACACATGCCAAGAGAGCGTACCGGGAGCTGGTCCTCATGAAGTG
T
GTGAACCATAAAAACATTATTAGTTTATTAAATGTCTTCACACCCCAGAAAACGCTGGAGGAGTTCCAA
GAT
GTTTACTTAGTAATGGAACTGATGGATGCCAACTTATGTCAAGTGATTCAGATGGAATTAGACCATG
AG
CGAATGTCTTACCTGCTGTACCAAATGTTGTGTGGCATTAAGCACCTCCATTCTGCTGGAATTATTCA
C
AGGGATTTAAAACCAAGTAACATTGTAGTCAAGTCTGATTGCACATTGAAAATCCTGGACTTTGGACTG
GCC
AGGACAGCAGGCACAAGCTTCATGATGACTCCATATGTGGTGACACGTTATTACAGAGCCCCTGAGG
TC
ATCCTGGGGATGGGCTACAAGGAGAACGTGGATATATGGTCTGTGGGATGCATTATGGGAGAAATGGT
T
CGCCACAAAATCCTCTTTCCAGGAAGGGACTATATTGACCAGTGGAATAAGGTAATTGAACAACTAGGA
ACA
CCATGTCCAGAATTCATGAAGAAATTGCAACCCACAGTAAGAAACTATGTGGAGAATCGGCCCAAGT
AT
GCGGGACTCACCTTCCCCAAACTCTTCCCAGATTCCCTCTTCCCAGCGGACTCCGAGCACAATAAACT
C
AAAGCCAGCCAAGCCAGGGACTTGTTGTCAAAGATGCTAGTGATTGACCCAGCAAAAAGAATATCAGTG
GAC
GACGCCTTACAGCATCCCTACATCAACGTCTGGTATGACCCAGCCGAAGTGGAGGCGCCTCCACCTC
AG
ATATATGACAAGCAGTTGGATGAAAGAGAACACACAATTGAAGAATGGAAAGAACTTATCTACAAGGA
A
GTAATGAATTCAGAAGAAAAGACTAAAAATGGTGTAGTAAAAGGACAGCCTTCTCCTTCAGCACAGGTG
CAG
CAGTGA


Translation (422 aa):
MSLHFLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPI
G
SGAQGIV
CAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQ
D
VYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGL
A
RTAGTSFMMTPYVVTRYYRAPEVILGMGYKEN
VDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLG
T
PCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLK
ASQARDLLSKMLVIDPAKRISV
D
DALQHPYINVWYDPAEVEA
PPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSAQV
Q
Q




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser