NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS43176.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
43176.1 Public Homo sapiens 3 ABCC5 22 109 92 CCDS HistoryNCBI Gene:10057Re-query CCDS DB by CCDS ID:43176.1Re-query CCDS DB by GeneID:10057See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 5, NCBI annotation release 36.3, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 43176.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000334444.10 ENSP00000333926.6 Accepted alive Link to Ensembl Transcript Viewer:ENST00000334444.10Link to Ensembl Protein Viewer:ENSP00000333926.6Re-query CCDS DB by Nucleotide ID:ENST00000334444Re-query CCDS DB by Protein ID:ENSP00000333926
Original member NCBI NM_005688.3 NP_005679.2 Updated not alive Link to Nucleotide Sequence:NM_005688.3Link to Protein Sequence:NP_005679.2Re-query CCDS DB by Nucleotide ID:NM_005688Re-query CCDS DB by Protein ID:NP_005679
Current member NCBI NM_005688.4 NP_005679.2 Accepted alive Link to Nucleotide Sequence:NM_005688.4Link to Protein Sequence:NP_005679.2Re-query CCDS DB by Nucleotide ID:NM_005688Re-query CCDS DB by Protein ID:NP_005679Link to BLAST:NP_005679.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_005679.2 1437 O15440-1 1437 100% 0 0

Chromosomal Locations for CCDS 43176.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 3 (NC_000003.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 183921300 183921401 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 183925555 183925719 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 183927330 183927443 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 183928747 183928825 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 183937901 183938060 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 183942727 183942916 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 183945850 183945939 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 183947324 183947510 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 183949753 183949881 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 183949972 183950125 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 183951441 183951570 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 183951857 183952003 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 183953086 183953270 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 183959733 183959835 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 183961511 183961654 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 183963385 183963588 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 183965185 183965257 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 183965377 183965501 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 183967695 183967766 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 183971563 183971919 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 183977517 183977624 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 183978503 183978651 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 183981727 183981874 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 183982451 183982624 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 183982774 183983007 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 183987770 183987917 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 183988572 183988727 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 183989226 183989383 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 184014264 184014392 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4314 nt):
ATGAAGGATATCGACATAGGAAAAGAGTATATCATCCCCAGTCCTGGGTATAGAAGTGTGAGGGAGAGAA
CC
AGCACTTCTGGGACGCACAGAGACCGTGAAGATTCCAAGTTCAGGAGAACTCGACCGTTGGAATGCCA
A
GATGCCTTGGAAACAGCAGCCCGAGCCGAGGGCCTCTCTCTTGATGCCTCCATGCATTCTCAGCTCAGA
ATC
CTGGATGAGGAGCATCCCAAGGGAAAGTACCATCATGGCTTGAGTGCTCTGAAGCCCATCCGGACTA
CT
TCCAAACACCAGCACCCAGTGGACAATGCTGGGCTTTTTTCCTGTATGACTTTTTCGTGGCTTTCTTC
T
CTGGCCCGTGTGGCCCACAAGAAGGGGGAGCTCTCAATGGAAGACGTGTGGTCTCTGTCCAAGCACGAG
TCT
TCTGACGTGAACTGCAGAAGACTAGAGAGACTGTGGCAAGAAGAGCTGAATGAAGTTGGGCCAGACG
CT
GCTTCCCTGCGAAGGGTTGTGTGGATCTTCTGCCGCACCAGGCTCATCCTGTCCATCGTGTGCCTGAT
G
ATCACGCAGCTGGCTGGCTTCAGTGGACCAGCCTTCATGGTGAAACACCTCTTGGAGTATACCCAGGCA
ACA
GAGTCTAACCTGCAGTACAGCTTGTTGTTAGTGCTGGGCCTCCTCCTGACGGAAATCGTGCGGTCTT
GG
TCGCTTGCACTGACTTGGGCATTGAATTACCGAACCGGTGTCCGCTTGCGGGGGGCCATCCTAACCAT
G
GCATTTAAGAAGATCCTTAAGTTAAAGAACATTAAAGAGAAATCCCTGGGTGAGCTCATCAACATTTGC
TCC
AACGATGGGCAGAGAATGTTTGAGGCAGCAGCCGTTGGCAGCCTGCTGGCTGGAGGACCCGTTGTTG
CC
ATCTTAGGCATGATTTATAATGTAATTATTCTGGGACCAACAGGCTTCCTGGGATCAGCTGTTTTTAT
C
CTCTTTTACCCAGCAATGATGTTTGCATCACGGCTCACAGCATATTTCAGGAGAAAATGCGTGGCCGCC
ACG
GATGAACGTGTCCAGAAGATGAATGAAGTTCTTACTTACATTAAATTTATCAAAATGTATGCCTGGG
TC
AAAGCATTTTCTCAGAGTGTTCAAAAAATCCGCGAGGAGGAGCGTCGGATATTGGAAAAAGCTGGGTA
C
TTCCAGAGCATCACTGTGGGTGTGGCTCCCATTGTGGTGGTGATTGCCAGCGTGGTGACCTTCTCTGTT
CAT
ATGACCCTGGGCTTCGATCTGACAGCAGCACAGGCTTTCACAGTGGTGACAGTCTTCAATTCCATGA
CT
TTTGCTTTGAAAGTAACACCGTTTTCAGTAAAGTCCCTCTCAGAAGCCTCAGTGGCTGTTGACAGATT
T
AAGAGTTTGTTTCTAATGGAAGAGGTTCACATGATAAAGAACAAACCAGCCAGTCCTCACATCAAGATA
GAG
ATGAAAAATGCCACCTTGGCATGGGACTCCTCCCACTCCAGTATCCAGAACTCGCCCAAGCTGACCC
CC
AAAATGAAAAAAGACAAGAGGGCTTCCAGGGGCAAGAAAGAGAAGGTGAGGCAGCTGCAGCGCACTGA
G
CATCAGGCGGTGCTGGCAGAGCAGAAAGGCCACCTCCTCCTGGACAGTGACGAGCGGCCCAGTCCCGAA
GAG
GAAGAAGGCAAGCACATCCACCTGGGCCACCTGCGCTTACAGAGGACACTGCACAGCATCGATCTGG
AG
ATCCAAGAGGGTAAACTGGTTGGAATCTGTGGCAGTGTGGGAAGTGGAAAAACCTCTCTCATTTCAGC
C
ATTTTAGGCCAGATGACGCTTCTAGAGGGCAGCATTGCAATCAGTGGAACCTTCGCTTATGTGGCCCAG
CAG
GCCTGGATCCTCAATGCTACTCTGAGAGACAACATCCTGTTTGGGAAGGAATATGATGAAGAAAGAT
AC
AACTCTGTGCTGAACAGCTGCTGCCTGAGGCCTGACCTGGCCATTCTTCCCAGCAGCGACCTGACGGA
G
ATTGGAGAGCGAGGAGCCAACCTGAGCGGTGGGCAGCGCCAGAGGATCAGCCTTGCCCGGGCCTTGTAT
AGT
GACAGGAGCATCTACATCCTGGACGACCCCCTCAGTGCCTTAGATGCCCATGTGGGCAACCACATCT
TC
AATAGTGCTATCCGGAAACATCTCAAGTCCAAGACAGTTCTGTTTGTTACCCACCAGTTACAGTACCT
G
GTTGACTGTGATGAAGTGATCTTCATGAAAGAGGGCTGTATTACGGAAAGAGGCACCCATGAGGAACTG
ATG
AATTTAAATGGTGACTATGCTACCATTTTTAATAACCTGTTGCTGGGAGAGACACCGCCAGTTGAGA
TC
AATTCAAAAAAGGAAACCAGTGGTTCACAGAAGAAGTCACAAGACAAGGGTCCTAAAACAGGATCAGT
A
AAGAAGGAAAAAGCAGTAAAGCCAGAGGAAGGGCAGCTTGTGCAGCTGGAAGAGAAAGGGCAGGGTTCA
GTG
CCCTGGTCAGTATATGGTGTCTACATCCAGGCTGCTGGGGGCCCCTTGGCATTCCTGGTTATTATGG
CC
CTTTTCATGCTGAATGTAGGCAGCACCGCCTTCAGCACCTGGTGGTTGAGTTACTGGATCAAGCAAGG
A
AGCGGGAACACCACTGTGACTCGAGGGAACGAGACCTCGGTGAGTGACAGCATGAAGGACAATCCTCAT
ATG
CAGTACTATGCCAGCATCTACGCCCTCTCCATGGCAGTCATGCTGATCCTGAAAGCCATTCGAGGAG
TT
GTCTTTGTCAAGGGCACGCTGCGAGCTTCCTCCCGGCTGCATGACGAGCTTTTCCGAAGGATCCTTCG
A
AGCCCTATGAAGTTTTTTGACACGACCCCCACAGGGAGGATTCTCAACAGGTTTTCCAAAGACATGGAT
GAA
GTTGACGTGCGGCTGCCGTTCCAGGCCGAGATGTTCATCCAGAACGTTATCCTGGTGTTCTTCTGTG
TG
GGAATGATCGCAGGAGTCTTCCCGTGGTTCCTTGTGGCAGTGGGGCCCCTTGTCATCCTCTTTTCAGT
C
CTGCACATTGTCTCCAGGGTCCTGATTCGGGAGCTGAAGCGTCTGGACAATATCACGCAGTCACCTTTC
CTC
TCCCACATCACGTCCAGCATACAGGGCCTTGCCACCATCCACGCCTACAATAAAGGGCAGGAGTTTC
TG
CACAGATACCAGGAGCTGCTGGATGACAACCAAGCTCCTTTTTTTTTGTTTACGTGTGCGATGCGGTG
G
CTGGCTGTGCGGCTGGACCTCATCAGCATCGCCCTCATCACCACCACGGGGCTGATGATCGTTCTTATG
CAC
GGGCAGATTCCCCCAGCCTATGCGGGTCTCGCCATCTCTTATGCTGTCCAGTTAACGGGGCTGTTCC
AG
TTTACGGTCAGACTGGCATCTGAGACAGAAGCTCGATTCACCTCGGTGGAGAGGATCAATCACTACAT
T
AAGACTCTGTCCTTGGAAGCACCTGCCAGAATTAAGAACAAGGCTCCCTCCCCTGACTGGCCCCAGGAG
GGA
GAGGTGACCTTTGAGAACGCAGAGATGAGGTACCGAGAAAACCTCCCTCTCGTCCTAAAGAAAGTAT
CC
TTCACGATCAAACCTAAAGAGAAGATTGGCATTGTGGGGCGGACAGGATCAGGGAAGTCCTCGCTGGG
G
ATGGCCCTCTTCCGTCTGGTGGAGTTATCTGGAGGCTGCATCAAGATTGATGGAGTGAGAATCAGTGAT
ATT
GGCCTTGCCGACCTCCGAAGCAAACTCTCTATCATTCCTCAAGAGCCGGTGCTGTTCAGTGGCACTG
TC
AGATCAAATTTGGACCCCTTCAACCAGTACACTGAAGACCAGATTTGGGATGCCCTGGAGAGGACACA
C
ATGAAAGAATGTATTGCTCAGCTACCTCTGAAACTTGAATCTGAAGTGATGGAGAATGGGGATAACTTC
TCA
GTGGGGGAACGGCAGCTCTTGTGCATAGCTAGAGCCCTGCTCCGCCACTGTAAGATTCTGATTTTAG
AT
GAAGCCACAGCTGCCATGGACACAGAGACAGACTTATTGATTCAAGAGACCATCCGAGAAGCATTTGC
A
GACTGTACCATGCTGACCATTGCCCATCGCCTGCACACGGTTCTAGGCTCCGATAGGATTATGGTGCTG
GCC
CAGGGACAGGTGGTGGAGTTTGACACCCCATCGGTCCTTCTGTCCAACGACAGTTCCCGATTCTATG
CC
ATGTTTGCTGCTGCAGAGAACAAGGTCGCTGTCAAGGGCTGA


Translation (1437 aa):
MKDIDIGKEYIIPSPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLSLDASMHSQLR
I
LDEEHPKGKYHHGLSALKPIRTTS
KHQHPVDNAGLFSCMTFSWLSSLARVAHKKGELSMEDVWSLSKHE
S
SDVNCR
RLERLWQEELNEVGPDAASLRRVVWIFCRTRLILSIVCLMITQLAGFSGPAFMVKHLLEYTQA
T
ESNLQYSLLLVLGLLLTEIVRSWSLALTWALNYRTGVRLRGAILTMAFKKILKLKNIKEKSLGE
LINIC
S
NDGQRMFEAAAVGSLLAGGPVVAILGMIYNVIILGPTGFLGSAVFILFYPAM
MFASRLTAYFRRKCVAA
T
DERVQKMNEVLTYIKFIKMYAWVKAFSQSVQ
KIREEERRILEKAGYFQSITVGVAPIVVVIASVVTFSV
H
MTLGFDLTAAQ
AFTVVTVFNSMTFALKVTPFSVKSLSEASVAVDRFKSLFLMEEVHMIKNKPASPHIKI
E
MKNATLAWDSSHSSIQNSPKLTPKMKKDKRASRGKKEKVRQLQRTEHQAVLAEQKGHLLLDSDERPSPE
E
EEGKHIHLGHLRLQRTLHSIDLEIQE
GKLVGICGSVGSGKTSLISAILGQMTLLEGSIAISGTFAYVAQ
Q
AWILNATLRDNILFGKEYDEE
RYNSVLNSCCLRPDLAILPSSDLTEIGERGANLSGGQRQRISLARALY
S
DRSIYILDDPLSALDAHVGNHIFNSAIRKHLKSKTVLFVTHQLQ
YLVDCDEVIFMKEGCITERGTHEEL
M
NLNGDYATIFNNLLLGETPPVE
INSKKETSGSQKKSQDKGPKTGSVKKEKAVKPEEGQLVQLEEKGQGS
V
PWSVYGVYIQAAGGPLAFLVIMALFMLNVGSTAFSTWWLSYWIKQGSG
NTTVTRGNETSVSDSMKDNPH
M
QYYASIYALSMAVMLILKAIRGVVFVK
GTLRASSRLHDELFRRILRSPMKFFDTTPTGRILNRFSKDMD
E
VDVRLPFQAEMFIQNVILVFFCVGMIAGVFPWFLVAVGPLVILFSVLHIVSRVLIRELKRLDNITQSPF
L
SHITSSIQGLATIHAYNKGQEFLH
RYQELLDDNQAPFFLFTCAMRWLAVRLDLISIALITTTGLMIVLM
H
GQIPPAYAGLAISYAVQ
LTGLFQFTVRLASETEARFTSVERINHYIKTLSLEAPARIKNKAPSPDWPQE
G
EVTFENAEMRYRENLPLVLKKVSFTIKPKEKIGIVGRTGS
GKSSLGMALFRLVELSGGCIKIDGVRISD
I
GLADLRSKLSIIPQEPVLFSGTV
RSNLDPFNQYTEDQIWDALERTHMKECIAQLPLKLESEVMENGDNF
S
VGERQLLCIARALLRHCK
ILILDEATAAMDTETDLLIQETIREAFADCTMLTIAHRLHTVLGSDRIMVL
A
QGQ
VVEFDTPSVLLSNDSSRFYAMFAAAENKVAVKG



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser