NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS43062.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
43062.1 Public Homo sapiens 3 GLB1 22 109 92 CCDS HistoryNCBI Gene:2720Re-query CCDS DB by CCDS ID:43062.1Re-query CCDS DB by GeneID:2720See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 5, NCBI annotation release 36.3, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 43062.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000399402.7 ENSP00000382333.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000399402.7Link to Ensembl Protein Viewer:ENSP00000382333.2Re-query CCDS DB by Nucleotide ID:ENST00000399402Re-query CCDS DB by Protein ID:ENSP00000382333
Original member NCBI NM_001079811.2 NP_001073279.1 Updated not alive Link to Nucleotide Sequence:NM_001079811.2Link to Protein Sequence:NP_001073279.1Re-query CCDS DB by Nucleotide ID:NM_001079811Re-query CCDS DB by Protein ID:NP_001073279
Current member NCBI NM_001079811.3 NP_001073279.2 Accepted alive Link to Nucleotide Sequence:NM_001079811.3Link to Protein Sequence:NP_001073279.2Re-query CCDS DB by Nucleotide ID:NM_001079811Re-query CCDS DB by Protein ID:NP_001073279Link to BLAST:NP_001073279.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001073279.2 647 P16278-3 647 99.8454% 0 1

Chromosomal Locations for CCDS 43062.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 3 (NC_000003.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 32997045 32997344 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 33014056 33014310 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 33016709 33016840 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 33018448 33018561 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 33021566 33021655 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 33024251 33024325 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 33046120 33046232 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 33051758 33051798 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 33051883 33052004 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 33053491 33053549 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 33058089 33058269 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 33065463 33065557 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 33068230 33068290 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 33068820 33068970 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3
3 33072544 33072698 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1944 nt):
ATGTTTGAAATTGACTATAGCCGGGACTCCTTCCTCAAGGATGGCCAGCCATTTCGCTACATCTCAGGAA
GC
ATTCACTACTCCCGTGTGCCCCGCTTCTACTGGAAGGACCGGCTGCTGAAGATGAAGATGGCTGGGCT
G
AACGCCATCCAGACGTATGTGCCCTGGAACTTTCATGAGCCCTGGCCAGGACAGTACCAGTTTTCTGAG
GAC
CATGATGTGGAATATTTTCTTCGGCTGGCTCATGAGCTGGGACTGCTGGTTATCCTGAGGCCCGGGC
CC
TACATCTGTGCAGAGTGGGAAATGGGAGGATTACCTGCTTGGCTGCTAGAGAAAGAGTCTATTCTTCT
C
CGCTCCTCCGACCCAGATTACCTGGCAGCTGTGGACAAGTGGTTGGGAGTCCTTCTGCCCAAGATGAAG
CCT
CTCCTCTATCAGAATGGAGGGCCAGTTATAACAGTGCAGGTTGAAAATGAATATGGCAGCTACTTTG
CC
TGTGATTTTGACTACCTGCGCTTCCTGCAGAAGCGCTTTCGCCACCATCTGGGGGATGATGTGGTTCT
G
TTTACCACTGATGGAGCACATAAAACATTCCTGAAATGTGGGGCCCTGCAGGGCCTCTACACCACGGTG
GAC
TTTGGAACAGGCAGCAACATCACAGATGCTTTCCTAAGCCAGAGGAAGTGTGAGCCCAAAGGACCCT
TG
ATCAATTCTGAATTCTATACTGGCTGGCTAGATCACTGGGGCCAACCTCACTCCACAATCAAGACCGA
A
GCAGTGGCTTCCTCCCTCTATGATATACTTGCCCGTGGGGCGAGTGTGAACTTGTACATGTTTATAGGT
GGG
ACCAATTTTGCCTATTGGAATGGGGCCAACTCACCCTATGCAGCACAGCCCACCAGCTACGACTATG
AT
GCCCCACTGAGTGAGGCTGGGGACCTCACTGAGAAGTATTTTGCTCTGCGAAACATCATCCAGAAGTT
T
GAAAAAGTACCAGAAGGTCCTATCCCTCCATCTACACCAAAGTTTGCATATGGAAAGGTCACTTTGGAA
AAG
TTAAAGACAGTGGGAGCAGCTCTGGACATTCTGTGTCCCTCTGGGCCCATCAAAAGCCTTTATCCCT
TG
ACATTTATCCAGGTGAAACAGCATTATGGGTTTGTGCTGTACCGGACAACACTTCCTCAAGATTGCAG
C
AACCCAGCACCTCTCTCTTCACCCCTCAATGGAGTCCACGATCGAGCATATGTTGCTGTGGATGGGATC
CCC
CAGGGAGTCCTTGAGCGAAACAATGTGATCACTCTGAACATAACAGGGAAAGCTGGAGCCACTCTGG
AC
CTTCTGGTAGAGAACATGGGACGTGTGAACTATGGTGCATATATCAACGATTTTAAGGGTTTGGTTTC
T
AACCTGACTCTCAGTTCCAATATCCTCACGGACTGGACGATCTTTCCACTGGACACTGAGGATGCAGTG
TGC
AGCCACCTGGGGGGCTGGGGACACCGTGACAGTGGCCACCATGATGAAGCCTGGGCCCACAACTCAT
CC
AACTACACGCTCCCGGCCTTTTATATGGGGAACTTCTCCATTCCCAGTGGGATCCCAGACTTGCCCCA
G
GACACCTTTATCCAGTTTCCTGGATGGACCAAGGGCCAGGTCTGGATTAATGGCTTTAACCTTGGCCGC
TAT
TGGCCAGCCCGGGGCCCTCAGTTGACCTTGTTTGTGCCCCAGCACATCCTGATGACCTCGGCCCCAA
AC
ACCATCACCGTGCTGGAACTGGAGTGGGCACCCTGCAGCAGTGATGATCCAGAACTATGTGCTGTGAC
G
TTCGTGGACAGGCCAGTTATTGGCTCATCTGTGACCTACGATCATCCCTCCAAACCTGTTGAAAAAAGA
CTC
ATGCCCCCACCCCCGCAAAAAAACAAAGATTCATGGCTGGACCATGTATGA


Translation (647 aa):
MFEIDYSRDSFLKDGQPFRYISGSIHYSRVPRFYWKDRLLKMKMAGLNAIQTYVPWNFHEPWPGQYQFSE
D
HDVEYFLRLAHELGLLVILRPGPYICAEWEM
GGLPAWLLEKESILLRSSDPDYLAAVDKWLGVLLPKMK
P
LLYQNGGPVITVQ
VENEYGSYFACDFDYLRFLQKRFRHHLGDDVVLFTTDGAHKTFLKCGALQGLYTTV
D
FGT
GSNITDAFLSQRKCEPKGPLINSEFYTGWLDHWGQPHSTIKTEAVASSLYDILARGASVNLYMFIG
G
TNFAYWN
GANSPYAAQPTSYDYDAPLSEAGDLTEKYFALRNIIQKFEKVPEGPIPPSTPKFAYGKVTLE
K
LKTVGAALDILCPSGPIKSLYPLTFIQVKQHYGFVLYRTTLPQDCSNPAPLSSPLNGVHDRAYVAVDGI
P
QGVLERNNVITLNITGKAGATLDLLVENMGRVNYGAYINDFK
GLVSNLTLSSNILTDWTIFPLDTEDAV
C
SHLGGWGHRDSGHHDEAWAHNSSNYTLPAFYMGNFSIPSGIPDLPQDTFIQFPGWTK
GQVWINGFNLGR
Y
WPARGPQLTLFVPQHILMTSAPNTITVLELEWAPCSSDDPELCAVTFVDRPVIGSSVTYDHPSKPVEKR
L
MPPPPQKNKDSWLDHV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser