NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS42646.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
42646.2 Public Homo sapiens 2 SH3YL1 22 109 92 CCDS HistoryNCBI Gene:26751Re-query CCDS DB by CCDS ID:42646.2Re-query CCDS DB by GeneID:26751See the combined annotation on chromosome 2 in Sequence Viewer

Public Note for CCDS 42646.1
The coding region has been updated to represent an alternative splicing pattern, resulting in an extended protein N-terminus that is more supported by the available transcript and protein data.

Public since: CCDS release 5, NCBI annotation release 36.3, Ensembl annotation release 47

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 42646.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000356150.9 ENSP00000348471.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000356150.9Link to Ensembl Protein Viewer:ENSP00000348471.5Re-query CCDS DB by Nucleotide ID:ENST00000356150Re-query CCDS DB by Protein ID:ENSP00000348471
Original member NCBI NM_015677.3 NP_056492.2 Updated not alive Link to Nucleotide Sequence:NM_015677.3Link to Protein Sequence:NP_056492.2Re-query CCDS DB by Nucleotide ID:NM_015677Re-query CCDS DB by Protein ID:NP_056492
Current member NCBI NM_015677.4 NP_056492.2 Accepted alive Link to Nucleotide Sequence:NM_015677.4Link to Protein Sequence:NP_056492.2Re-query CCDS DB by Nucleotide ID:NM_015677Re-query CCDS DB by Protein ID:NP_056492Link to BLAST:NP_056492.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_056492.2 342 Q96HL8-1 342 100% 0 0

Chromosomal Locations for CCDS 42646.2

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 2 (NC_000002.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 218811 219001 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 224864 224920 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 229966 230044 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 231023 231191 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 233101 233229 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 234160 234272 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 247538 247602 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 249731 249844 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 253005 253115 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 263984 263984 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1029 nt):
ATGAATAACCCTATACCTTCCAATTTGAAATCAGAAGCAAAAAAGGCTGCCAAAATATTAAGAGAATTCA
CA
GAAATAACTTCCAGAAATGGACCTGATAAGATCATTCCTGCTCACGTAATTGCGAAGGCTAAAGGCCT
T
GCAATTCTGTCTGTGATCAAAGCCGGGTTCCTGGTGACTGCCAGAGGAGGCAGCGGGATTGTAGTGGCG
CGC
CTTCCAGATGGAAAATGGTCTGCACCCTCAGCCATTGGGATAGCTGGCCTTGGTGGAGGATTTGAAA
TA
GGAATTGAGGTATCAGACTTGGTGATAATTCTGAATTATGACCGTGCTGTAGAAGCTTTTGCAAAAGG
C
GGAAATCTGACCCTCGGAGGGAACTTGACTGTGGCGGTTGGGCCCTTGGGAAGGAACTTGGAAGGAAAC
GTG
GCCCTGAGAAGCTCCGCTGCCGTCTTCACGTACTGCAAGTCAAGGGGACTCTTTGCAGGCGTGTCTT
TA
GAAGGGAGCTGTTTGATTGAAAGGAAAGAAACTAATAGAAAATTTTATTGTCAAGATATCCGAGCTTA
T
GACATTTTATTTGGAGATACACCGCGGCCTGCTCAAGCCGAAGATCTTTATGAAATTCTTGATTCCTTT
ACT
GAAAAGTATGAAAATGAAGGACAACGAATCAATGCAAGAAAAGCAGCAAGGGAGCAGAGGAAGTCTT
CT
GCTAAAGAATTACCTCCAAAGCCATTGTCAAGACCACAGCAGTCATCTGCACCAGTCCAGCTGAACTC
T
GGCTCTCAAAGTAACAGAAATGAATATAAGCTCTATCCTGGACTTTCCAGCTATCATGAGAGAGTTGGC
AAT
TTGAATCAACCCATAGAAGTGACAGCGCTGTATTCATTTGAAGGACAGCAGCCTGGGGATTTGAATT
TT
CAAGCTGGAGACAGAATCACAGTTATATCAAAAACAGATTCACATTTTGATTGGTGGGAAGGAAAACT
T
CGAGGTCAAACTGGCATTTTTCCAGCCAACTACGTAACCATGAATTAA


Translation (342 aa):
MNNPIPSNLKSEAKKAAKILREFTEITSRNGPDKIIPAHVIAKAKGLAILSVIKAGFLVTARGGSGIVVA
R
LPDG
KWSAPSAIGIAGLGGGFEIGIEVSDLVIILNYDRAVEAFAKGGNLTLGGNLTVAVGPLGRNLEGN
V
ALRSSAAVFTYCKSRGLFAGVSLEGSCLIERKETNR
KFYCQDIRAYDILFGDTPRPAQAEDLYEILDSF
T
EKYENEGQRINARKAAREQRKSS
AKELPPKPLSRPQQSSAPVQLNSGSQSNRNEYKLYPGLSSYHERVG
N
LNQPIEVTALYSFEGQQPGDLNFQAGDRITVISKTDSHFDWWEGKLRGQTGIFPANYVTMN




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser