NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS42422.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
42422.1 Public Homo sapiens 18 CHST9 22 109 92 CCDS HistoryNCBI Gene:83539Re-query CCDS DB by CCDS ID:42422.1Re-query CCDS DB by GeneID:83539See the combined annotation on chromosome 18 in Sequence Viewer

Public since: CCDS release 5, NCBI annotation release 36.3, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 42422.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000581714.5 ENSP00000462852.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000581714.5Link to Ensembl Protein Viewer:ENSP00000462852.1Re-query CCDS DB by Nucleotide ID:ENST00000581714Re-query CCDS DB by Protein ID:ENSP00000462852
Original member Current member EBI,WTSI ENST00000618847.4 ENSP00000480991.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000618847.4Link to Ensembl Protein Viewer:ENSP00000480991.1Re-query CCDS DB by Nucleotide ID:ENST00000618847Re-query CCDS DB by Protein ID:ENSP00000480991
Original member Current member NCBI NM_031422.5 NP_113610.2 Accepted alive Link to Nucleotide Sequence:NM_031422.5Link to Protein Sequence:NP_113610.2Re-query CCDS DB by Nucleotide ID:NM_031422Re-query CCDS DB by Protein ID:NP_113610Link to BLAST:NP_113610.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_113610.2 443 Q7L1S5-1 443 100% 0 0

Chromosomal Locations for CCDS 42422.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 18 (NC_000018.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18See the combined annotation on chromosome 18 in Sequence Viewer

Chromosome Start Stop Links
18 26916259 26917350 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 26944329 26944366 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 27024116 27024157 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 27048465 27048503 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 27142689 27142809 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1332 nt):
ATGCAGCCATCTGAAATGGTCATGAACCCCAAACAAGTCTTCCTCTCTGTGCTGATATTTGGAGTAGCTG
GG
CTACTCCTCTTCATGTATTTGCAAGTCTGGATTGAAGAACAACATACAGGGAGAGTGGAGAAGAGAAG
A
GAACAAAAAGTAACTTCAGGATGGGGACCAGTGAAGTACTTGCGGCCTGTACCCAGAATCATGAGTACA
GAA
AAAATCCAGGAACATATCACCAACCAGAACCCCAAGTTTCACATGCCTGAGGATGTACGAGAAAAAA
AG
GAAAATCTTCTACTCAATTCTGAGAGATCTACTAGGCTCTTAACAAAGACCAGTCATTCACAAGGAGG
G
GATCAAGCTTTAAGTAAGTCCACAGGGTCACCAACAGAGAAGTTGATTGAAAAACGTCAAGGAGCTAAG
ACT
GTTTTTAACAAGTTCAGCAACATGAATTGGCCAGTGGACATTCACCCTTTAAACAAAAGTTTAGTCA
AA
GATAATAAATGGAAGAAAACTGAGGAGACCCAAGAGAAACGAAGGTCTTTCCTTCAGGAGTTTTGCAA
G
AAATACGGTGGGGTGAGTCATCATCAGTCACATCTTTTTCATACAGTATCCAGAATCTATGTAGAAGAT
AAA
CACAAAATCTTATATTGTGAGGTACCTAAGGCTGGCTGTTCCAATTGGAAAAGAATTCTGATGGTAC
TA
AATGGATTGGCTTCCTCTGCATACAACATCTCCCACAATGCTGTCCACTACGGGAAGCATTTGAAGAA
G
CTAGATAGCTTTGACCTAAAAGGGATATATACCCGCTTAAATACTTACACCAAAGCTGTGTTTGTTCGT
GAT
CCCATGGAAAGATTAGTATCAGCCTTTAGGGACAAATTTGAACACCCCAATAGTTATTACCATCCAG
TA
TTCGGAAAGGCAATTATCAAGAAATATCGACCAAATGCCTGTGAAGAAGCATTAATTAATGGATCTGG
A
GTCAAGTTCAAAGAGTTTATCCACTACTTGCTGGATTCCCACCGTCCAGTAGGAATGGACATTCACTGG
GAA
AAGGTCAGCAAACTCTGCTATCCGTGTTTGATCAACTATGATTTTGTAGGGAAATTTGAGACTTTGG
AA
GAAGATGCCAATTACTTTTTACAGATGATCGGTGCTCCAAAGGAGCTGAAATTTCCCAACTTTAAGGA
T
AGGCACTCTTCCGATGAAAGAACCAATGCTCAAGTCGTGAGACAGTATTTAAAGGATCTGACTAGAACT
GAG
AGACAATTAATCTATGACTTTTATTACTTGGACTATTTAATGTTTAATTATACAACTCCATTTTTGT
AG


Translation (443 aa):
MQPSEMVMNPKQVFLSVLIFGVAGLLLFMYLQVWIEEQHTGRVEKRREQKVTSGWGPVKYLRPVPRIMST
E
KIQEHITNQ
NPKFHMPEDVREKKENLLLNSERSTRLLTKTSHSQGGDQALSKSTGSPTEKLIEKRQGAK
T
VFNKFSNMNWPVDIHPLNKSLVKDNKWKKTEETQEKRRSFLQEFCKKYGGVSHHQSHLFHTVSRIYVED
K
HKILYCEVPKAGCSNWKRILMVLNGLASSAYNISHNAVHYGKHLKKLDSFDLKGIYTRLNTYTKAVFVR
D
PMERLVSAFRDKFEHPNSYYHPVFGKAIIKKYRPNACEEALINGSGVKFKEFIHYLLDSHRPVGMDIHW
E
KVSKLCYPCLINYDFVGKFETLEEDANYFLQMIGAPKELKFPNFKDRHSSDERTNAQVVRQYLKDLTRT
E
RQLIYDFYYLDYLMFNYTTPFL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser