NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS42221.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
42221.1 Public Homo sapiens 16 FANCA 22 109 92 CCDS HistoryNCBI Gene:2175Re-query CCDS DB by CCDS ID:42221.1Re-query CCDS DB by GeneID:2175See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 5, NCBI annotation release 36.3, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 42221.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000389302.7 ENSP00000373953.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000389302.7Link to Ensembl Protein Viewer:ENSP00000373953.3Re-query CCDS DB by Nucleotide ID:ENST00000389302Re-query CCDS DB by Protein ID:ENSP00000373953
Original member NCBI NM_001018112.2 NP_001018122.1 Updated not alive Link to Nucleotide Sequence:NM_001018112.2Link to Protein Sequence:NP_001018122.1Re-query CCDS DB by Nucleotide ID:NM_001018112Re-query CCDS DB by Protein ID:NP_001018122
Current member NCBI NM_001018112.3 NP_001018122.1 Accepted alive Link to Nucleotide Sequence:NM_001018112.3Link to Protein Sequence:NP_001018122.1Re-query CCDS DB by Nucleotide ID:NM_001018112Re-query CCDS DB by Protein ID:NP_001018122Link to BLAST:NP_001018122.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001018122.1 297 O15360-2 297 100% 0 0

Chromosomal Locations for CCDS 42221.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 16 (NC_000016.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 89799079 89799079 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89799166 89799232 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89799605 89799638 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89803259 89803341 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89805280 89805392 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89808294 89808367 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89810707 89810802 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89810929 89811071 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89814520 89814613 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89815877 89815986 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89816537 89816615 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (894 nt):
ATGTCCGACTCGTGGGTCCCGAACTCCGCCTCGGGCCAGGACCCAGGGGGCCGCCGGAGGGCCTGGGCCG
AG
CTGCTGGCGGGAAGGGTCAAGAGGGAAAAATATAATCCTGAAAGGGCACAGAAATTAAAGGAATCAGC
T
GTGCGCCTCCTGCGAAGCCATCAGGACCTGAATGCCCTTTTGCTTGAGGTAGAAGGTCCACTGTGTAAA
AAA
TTGTCTCTCAGCAAAGTGATTGACTGTGACAGTTCTGAGGCCTATGCTAATCATTCTAGTTCATTTA
TA
GGCTCTGCTTTGCAGGATCAAGCCTCAAGGCTGGGGGTTCCCGTGGGTATTCTCTCAGCCGGGATGGT
T
GCCTCTAGCGTGGGACAGATCTGCACGGCTCCAGCGGAGACCAGTCACCCTGTGCTGCTGACTGTGGAG
CAG
AGAAAGAAGCTGTCTTCCCTGTTAGAGTTTGCTCAGTATTTATTGGCACACAGTATGTTCTCCCGTC
TT
TCCTTCTGTCAAGAATTATGGAAAATACAGAGTTCTTTGTTGCTTGAAGCGGTGTGGCATCTTCACGT
A
CAAGGCATTGTGAGCCTGCAAGAGCTGCTGGAAAGCCATCCCGACATGCATGCTGTGGGATCGTGGCTC
TTC
AGGAATCTGTGCTGCCTTTGTGAACAGATGGAAGCATCCTGCCAGCATGCTGACGTCGCCAGGGCCA
TG
CTTTCTGATTTTGTTCAAATGTTTGTTTTGAGGGGATTTCAGAAAAACTCAGATCTGAGAAGAACTGT
G
GAGCCTGAAAAAATGCCGCAGGTCACGGTTGATGTACTGCAGAGAATGCTGATTTTTGCACTTGACGCT
TTG
GCTGCTGGAGTACAGGAGGAGTCCTCCACTCACAAGATCGTGAGGTGCTGA


Translation (297 aa):
MSDSWVPNSASGQDPGGRRRAWAELLAGRVKREKYNPERAQKLKESAVRLLRSHQDLNALLLEVEGPLCK
K
LSLSKVIDCDSSEAYANHSSSFI
GSALQDQASRLGVPVGILSAGMVASSVGQICTAPAETSHPVLLTVE
Q
R
KKLSSLLEFAQYLLAHSMFSRLSFCQELWKIQSSLLLEAVWHLHVQGIVSLQELLESHPDMHAVGSWL
F
RNLCCLCEQMEASCQHADVARAMLS
DFVQMFVLRGFQKNSDLRRTVEPEKMPQVTVDVLQRMLIFALDA
L
AAGVQEESSTHKIVRC




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser