NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS42116.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
42116.2 Public Homo sapiens 16 C16orf89 22 109 92 CCDS HistoryNCBI Gene:146556Re-query CCDS DB by CCDS ID:42116.2Re-query CCDS DB by GeneID:146556See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 5, NCBI annotation release 36.3, Ensembl annotation release 47

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)


Attributes
CDS uses downstream AUG

Sequence IDs included in CCDS 42116.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000315997.5 ENSP00000324672.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000315997.5Link to Ensembl Protein Viewer:ENSP00000324672.5Re-query CCDS DB by Nucleotide ID:ENST00000315997Re-query CCDS DB by Protein ID:ENSP00000324672
Original member Current member NCBI NM_152459.4 NP_689672.4 Accepted alive Link to Nucleotide Sequence:NM_152459.4Link to Protein Sequence:NP_689672.4Re-query CCDS DB by Nucleotide ID:NM_152459Re-query CCDS DB by Protein ID:NP_689672Link to BLAST:NP_689672.4

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_689672.4 402 Q6UX73-1 402 100% 0 0

Chromosomal Locations for CCDS 42116.2

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 16 (NC_000016.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 5044583 5044836 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 5047878 5047964 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 5055246 5055350 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 5056053 5056188 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 5058493 5058610 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 5060286 5060436 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 5062425 5062574 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 5065701 5065908 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1209 nt):
ATGGCCAGCCTGGGGCTGCTGCTCCTGCTCTTACTGACAGCACTGCCACCGCTGTGGTCCTCCTCACTGC
CT
GGGCTGGACACTGCTGAAAGTAAAGCCACCATTGCAGACCTGATCCTGTCTGCGCTGGAGAGAGCCAC
C
GTCTTCCTAGAACAGAGGCTGCCTGAAATCAACCTGGATGGCATGGTGGGGGTCCGAGTGCTGGAAGAG
CAG
CTAAAAAGTGTCCGGGAGAAGTGGGCCCAGGAGCCCCTGCTGCAGCCGCTGAGCCTGCGCGTGGGGA
TG
CTGGGGGAGAAGCTGGAGGCTGCCATCCAGAGATCCCTCCACTACCTCAAGCTGAGTGATCCCAAGTA
C
CTAAGAGAGTTCCAGCTGACCCTCCAGCCCGGGTTTTGGAAGCTCCCACATGCCTGGATCCACACTGAT
GCC
TCCTTGGTGTACCCCACGTTCGGGCCCCAGGACTCATTCTCAGAGGAGAGAAGTGACGTGTGCCTGG
TG
CAGCTGCTGGGAACCGGGACGGACAGCAGCGAGCCCTGCGGCCTCTCAGACCTCTGCAGGAGCCTCAT
G
ACCAAGCCCGGCTGCTCAGGCTACTGCCTGTCCCACCAACTGCTCTTCTTCCTCTGGGCCAGAATGAGG
GGG
TGCACACAGGGACCACTCCAACAGAGCCAGGACTATATCAACCTCTTCTGCGCCAACATGATGGACT
TG
AACCGCAGAGCTGAGGCCATCGGATACGCCTACCCTACCCGGGACATCTTCATGGAAAACATCATGTT
C
TGTGGAATGGGCGGCTTCTCCGACTTCTACAAGCTCCGGTGGCTGGAGGCCATTCTCAGCTGGCAGAAA
CAG
CAGGAAGGATGCTTCGGGGAGCCTGATGCTGAAGATGAAGAATTATCTAAAGCTATTCAATATCAGC
AG
CATTTTTCGAGGAGAGTGAAGAGGCGAGAAAAACAATTTCCAGATTCTCGCTCTGTTGCTCAGGCTGG
A
GTACAGTGGCGCAATCTCGGCTCACTGCAACCTTTGCCTCCTGGGTTCAAGCAATTCTCTTGCCTCATC
CTC
CCGAGTAGCTGGGACTACAGGAGCGTGCCACCATACCTGGCTAATTTTTATATTTTTTTAGTAGAGA
CA
GGGTTTCATCATGTTGCTCATGCTGGTCTCGAACTCCTGATCTCAAGAGATCCGCCCACCTCAGGCTC
C
CAAAGTGTGGGATTATAG


Translation (402 aa):
MASLGLLLLLLLTALPPLWSSSLPGLDTAESKATIADLILSALERATVFLEQRLPEINLDGMVGVRVLEE
Q
LKSVREKWAQEPLLQPLSLRVGMLGEKLEAAIQRSLHYLKLSDPKYLR
EFQLTLQPGFWKLPHAWIHTD
A
SLVYPTFGPQDSFSEERSDVCLVQLLGT
GTDSSEPCGLSDLCRSLMTKPGCSGYCLSHQLLFFLWARMR
G
CTQGPLQQSQDYINLFCANMMDLNRRAEAIGYAYPTRDIFMEN
IMFCGMGGFSDFYKLRWLEAILSWQK
Q
QEGCFGEP
DAEDEELSKAIQYQQHFSRRVKRREKQFPDSRSVAQAGVQWRNLGSLQPLPPGFKQFSCLI
L
PSSWDYRSVPPYLANFYIFLVETGFHHVAHAGLELLISRDPPTSGSQSVGL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser