NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS4210.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
4210.1 Public Homo sapiens 5 MATR3 22 109 92 CCDS HistoryNCBI Gene:9782Re-query CCDS DB by CCDS ID:4210.1Re-query CCDS DB by GeneID:9782See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 4210.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000361059.7 ENSP00000354346.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000361059.7Link to Ensembl Protein Viewer:ENSP00000354346.4Re-query CCDS DB by Nucleotide ID:ENST00000361059Re-query CCDS DB by Protein ID:ENSP00000354346
Original member Current member EBI ENST00000394805.7 ENSP00000378284.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000394805.7Link to Ensembl Protein Viewer:ENSP00000378284.3Re-query CCDS DB by Nucleotide ID:ENST00000394805Re-query CCDS DB by Protein ID:ENSP00000378284
Original member Current member EBI ENST00000509990.5 ENSP00000423533.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000509990.5Link to Ensembl Protein Viewer:ENSP00000423533.1Re-query CCDS DB by Nucleotide ID:ENST00000509990Re-query CCDS DB by Protein ID:ENSP00000423533
Original member Current member EBI ENST00000618441.5 ENSP00000482895.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000618441.5Link to Ensembl Protein Viewer:ENSP00000482895.1Re-query CCDS DB by Nucleotide ID:ENST00000618441Re-query CCDS DB by Protein ID:ENSP00000482895
Original member NCBI NM_001194954.1 NP_001181883.1 Updated not alive Link to Nucleotide Sequence:NM_001194954.1Link to Protein Sequence:NP_001181883.1Re-query CCDS DB by Nucleotide ID:NM_001194954Re-query CCDS DB by Protein ID:NP_001181883
Current member NCBI NM_001194954.2 NP_001181883.1 Accepted alive Link to Nucleotide Sequence:NM_001194954.2Link to Protein Sequence:NP_001181883.1Re-query CCDS DB by Nucleotide ID:NM_001194954Re-query CCDS DB by Protein ID:NP_001181883Link to BLAST:NP_001181883.1
Original member NCBI NM_001194955.1 NP_001181884.1 Updated not alive Link to Nucleotide Sequence:NM_001194955.1Link to Protein Sequence:NP_001181884.1Re-query CCDS DB by Nucleotide ID:NM_001194955Re-query CCDS DB by Protein ID:NP_001181884
Current member NCBI NM_001194955.2 NP_001181884.1 Accepted alive Link to Nucleotide Sequence:NM_001194955.2Link to Protein Sequence:NP_001181884.1Re-query CCDS DB by Nucleotide ID:NM_001194955Re-query CCDS DB by Protein ID:NP_001181884Link to BLAST:NP_001181884.1
Original member NCBI NM_018834.5 NP_061322.2 Updated not alive Link to Nucleotide Sequence:NM_018834.5Link to Protein Sequence:NP_061322.2Re-query CCDS DB by Nucleotide ID:NM_018834Re-query CCDS DB by Protein ID:NP_061322
Current member NCBI NM_018834.6 NP_061322.2 Accepted alive Link to Nucleotide Sequence:NM_018834.6Link to Protein Sequence:NP_061322.2Re-query CCDS DB by Nucleotide ID:NM_018834Re-query CCDS DB by Protein ID:NP_061322Link to BLAST:NP_061322.2
Original member NCBI NM_199189.2 NP_954659.1 Updated not alive Link to Nucleotide Sequence:NM_199189.2Link to Protein Sequence:NP_954659.1Re-query CCDS DB by Nucleotide ID:NM_199189Re-query CCDS DB by Protein ID:NP_954659
Current member NCBI NM_199189.3 NP_954659.1 Accepted alive Link to Nucleotide Sequence:NM_199189.3Link to Protein Sequence:NP_954659.1Re-query CCDS DB by Nucleotide ID:NM_199189Re-query CCDS DB by Protein ID:NP_954659Link to BLAST:NP_954659.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001181883.1 847 P43243-1 847 100% 0 0
NP_001181884.1 847 P43243-1 847 100% 0 0
NP_061322.2 847 P43243-1 847 100% 0 0
NP_954659.1 847 P43243-1 847 100% 0 0

Chromosomal Locations for CCDS 4210.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 5 (NC_000005.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 139307416 139308327 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 139314675 139314736 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 139315697 139315738 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 139316076 139316188 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 139317053 139317105 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 139317596 139317721 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 139318908 139319033 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 139319334 139319501 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 139321898 139322029 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 139322463 139322506 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 139322598 139322967 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 139325440 139325662 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 139326163 139326284 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 139329345 139329395 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2544 nt):
ATGTCCAAGTCATTCCAGCAGTCATCTCTCAGTAGGGACTCACAGGGTCATGGGCGTGACCTGTCTGCGG
CA
GGAATAGGCCTTCTTGCTGCTGCTACCCAGTCTTTAAGTATGCCAGCATCTCTTGGAAGGATGAACCA
G
GGTACTGCACGCCTTGCTAGTTTAATGAATCTTGGAATGAGTTCTTCATTGAATCAACAAGGAGCTCAT
AGT
GCACTGTCTTCTGCTAGTACTTCTTCCCATAATTTGCAGTCTATATTTAACATTGGAAGTAGAGGTC
CA
CTCCCTTTATCTTCTCAACACCGTGGAGATGCAGACCAGGCCAGTAACATTTTGGCCAGCTTTGGTCT
G
TCTGCTAGAGACTTAGATGAACTGAGTCGTTATCCAGAGGACAAGATTACTCCTGAGAATTTGCCCCAA
ATC
CTTCTACAGCTTAAAAGGAGGAGAACTGAAGAAGGCCCTACCTTGAGTTATGGTAGAGATGGCAGAT
CT
GCTACACGGGAGCCACCATACAGAGTACCTAGGGATGATTGGGAAGAAAAAAGGCACTTTAGAAGAGA
T
AGTTTTGATGATCGTGGTCCTAGTCTCAACCCAGTGCTTGATTATGACCATGGAAGTCGTTCTCAAGAA
TCT
GGTTATTATGACAGAATGGATTATGAAGATGACAGATTAAGAGATGGAGAAAGGTGTAGGGATGATT
CT
TTTTTTGGTGAGACCTCGCATAACTATCATAAATTTGACAGTGAGTATGAGAGAATGGGACGTGGTCC
T
GGCCCCTTACAAGAGAGATCTCTCTTTGAGAAAAAGAGAGGCGCTCCTCCAAGTAGCAATATTGAAGAC
TTC
CATGGACTCTTACCGAAGGGTTATCCCCATCTGTGCTCTATATGTGATTTGCCAGTTCATTCTAATA
AG
GAGTGGAGTCAACATATCAATGGAGCAAGTCACAGTCGTCGATGCCAGCTTCTTCTTGAAATCTACCC
A
GAATGGAATCCTGACAATGATACAGGACACACAATGGGTGATCCATTCATGTTGCAGCAGTCTACAAAT
CCA
GCACCAGGAATTCTGGGACCTCCACCTCCCTCATTTCATCTTGGGGGACCAGCAGTTGGACCAAGAG
GA
AATCTGGGTGCTGGAAATGGAAACCTGCAAGGACCTAGACACATGCAGAAAGGCAGAGTGGAAACTAG
C
AGAGTTGTTCACATCATGGATTTTCAACGAGGGAAAAACTTGAGATACCAGCTATTACAGCTGGTAGAA
CCA
TTTGGAGTCATTTCAAATCATCTGATTCTAAATAAAATTAATGAGGCATTTATTGAAATGGCAACCA
CA
GAGGATGCTCAGGCCGCAGTGGATTATTACACAACCACACCAGCGTTAGTATTTGGCAAGCCAGTGAG
A
GTTCATTTATCCCAGAAGTATAAAAGAATAAAGAAACCTGAAGGAAAGCCAGATCAGAAGTTTGATCAA
AAG
CAAGAGCTTGGACGTGTGATACATCTCAGCAATTTGCCGCATTCTGGCTATTCTGATAGTGCTGTTC
TC
AAGCTTGCTGAGCCTTATGGGAAAATAAAGAATTACATATTGATGAGGATGAAAAGTCAGGCTTTTAT
T
GAGATGGAGACAAGAGAAGATGCAATGGCAATGGTTGACCATTGTTTGAAAAAAGCCCTTTGGTTTCAG
GGG
AGATGTGTGAAGGTTGACCTGTCTGAGAAATATAAAAAACTGGTTCTGAGGATTCCAAACAGAGGCA
TT
GATTTACTGAAAAAAGATAAATCCCGAAAAAGATCTTACTCTCCAGATGGCAAAGAATCTCCAAGTGA
T
AAGAAATCCAAAACTGATGGTTCCCAGAAGACTGAGAGTTCAACCGAAGGTAAAGAACAAGAAGAGAAG
TCC
GGTGAAGATGGTGAGAAAGACACAAAGGATGACCAGACAGAGCAGGAACCTAATATGCTTCTTGAAT
CT
GAAGATGAGCTACTTGTAGATGAAGAAGAAGCAGCAGCACTGCTAGAAAGTGGCAGTTCAGTGGGAGA
C
GAGACCGATCTTGCTAATTTAGGTGATGTGGCTTCTGATGGGAAAAAGGAACCATCAGATAAAGCTGTG
AAA
AAAGATGGAAGTGCTTCAGCAGCAGCAAAGAAAAAGCTTAAAAAGGTGGACAAGATCGAGGAACTTG
AT
CAAGAAAACGAAGCAGCGTTGGAAAATGGAATTAAAAATGAGGAAAACACAGAACCAGGTGCTGAATC
T
TCTGAGAACGCTGATGATCCCAACAAAGATACAAGTGAAAACGCAGATGGTCAAAGTGATGAGAACAAG
GAC
GACTATACAATCCCAGATGAGTATAGAATTGGACCATATCAGCCCAATGTTCCTGTTGGTATAGACT
AT
GTGATACCTAAAACAGGGTTTTACTGTAAGCTGTGTTCACTCTTTTATACAAATGAAGAAGTTGCAAA
G
AATACTCATTGCAGCAGCCTTCCTCATTATCAGAAATTAAAGAAATTTCTGAATAAATTGGCAGAAGAA
CGC
AGACAGAAGAAGGAAACTTAA


Translation (847 aa):
MSKSFQQSSLSRDSQGHGRDLSAAGIGLLAAATQSLSMPASLGRMNQGTARLASLMNLGMSSSLNQQGAH
S
ALSSASTSSHNLQSIFNIGSRGPLPLSSQHRGDADQASNILASFGLSARDLDELSRYPEDKITPENLPQ
I
LLQLKRRRTEEGPTLSYGRDGRSATREPPYRVPRDDWEEKRHFRRDSFDDRGPSLNPVLDYDHGSRSQE
S
GYYDRMDYEDDRLRDGERCRDDSFFGETSHNYHKFDSEYERMGRGPGPLQERSLFEKKRGAPPSSNIED
F
HGLLPKGYPHLCSICDLPVHSNK
EWSQHINGASHSRRCQLLLEIYPEWNPDNDTGHTMGDPFMLQQSTN
P
APGILGPPPPSFHLGGPAVGPRGNL
GAGNGNLQGPRHMQKGRVETSRVVHIMDFQRGKNLRYQLLQLVE
P
FGVISNHLILNKINE
AFIEMATTEDAQAAVDYYTTTPALVFGKPVRVHLSQKYKRIKKPEGKPDQKFDQ
K
QELGRVIHLSNLPHSGYSDSAVLKLAEPYGKIKNYILMRMKSQ
AFIEMETREDAMAMVDHCLKKALWFQ
G
RCVKVDLSEKYKKLVLR
IPNRGIDLLKKDKSRKRSYSPDGKESPSDKKSKTDGSQKTESSTEGKEQEEK
S
GEDGEKDTKDDQTEQEPNMLLESEDELLVDEEEAAALLESGSSVGDETDLANLGDVASDGKKEPSDKAV
K
KDGSASAAAKKKLKK
VDKIEELDQENEAALENGIKNEENTEPGAESSENADDPNKDTSENADGQSDENK
D
DYTIPDEYRIGPYQPNVPV
GIDYVIPKTGFYCKLCSLFYTNEEVAKNTHCSSLPHYQKLKKFLNKLAEE
R
RQKKET




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser