NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS42050.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
42050.1 Public Homo sapiens 15 AAGAB 22 109 92 CCDS HistoryNCBI Gene:79719Re-query CCDS DB by CCDS ID:42050.1Re-query CCDS DB by GeneID:79719See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 5, NCBI annotation release 36.3, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 42050.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000261880.9 ENSP00000261880.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000261880.9Link to Ensembl Protein Viewer:ENSP00000261880.5Re-query CCDS DB by Nucleotide ID:ENST00000261880Re-query CCDS DB by Protein ID:ENSP00000261880
Original member Current member NCBI NM_024666.4 NP_078942.3 Accepted alive Link to Nucleotide Sequence:NM_024666.4Link to Protein Sequence:NP_078942.3Re-query CCDS DB by Nucleotide ID:NM_024666Re-query CCDS DB by Protein ID:NP_078942Link to BLAST:NP_078942.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_078942.3 315 Q6PD74-1 315 100% 0 0

Chromosomal Locations for CCDS 42050.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 15 (NC_000015.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 67202821 67202898 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 67203548 67203597 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 67204044 67204148 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 67208562 67208658 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 67209462 67209544 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 67231814 67231897 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 67235979 67236068 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 67236408 67236504 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 67236630 67236820 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 67254559 67254631 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (948 nt):
ATGGCTGCTGGCGTACCCTGTGCGTTAGTCACCAGCTGCTCCTCCGTCTTCTCAGGAGACCAGCTGGTCC
AA
CATATCCTTGGAACAGAAGATCTTATTGTGGAAGTGACTTCCAATGATGCTGTGAGATTTTATCCCTG
G
ACCATTGATAATAAATACTATTCAGCAGACATCAATCTATGTGTGGTGCCAAACAAATTTCTTGTTACT
GCA
GAGATTGCAGAATCTGTCCAAGCATTTGTGGTTTACTTTGACAGCACACAAAAATCGGGCCTTGATA
GT
GTCTCCTCATGGCTTCCACTGGCAAAAGCATGGTTACCTGAGGTGATGATCTTGGTCTGCGATAGAGT
G
TCTGAAGATGGTATAAACCGACAAAAAGCTCAAGAATGGTGCATCAAACATGGCTTTGAATTGGTAGAA
CTT
AGTCCAGAGGAGTTGCCTGAGGAGGATGATGACTTCCCAGAATCTACAGGAGTAAAGCGAATTGTCC
AA
GCCCTGAATGCCAATGTGTGGTCCAATGTAGTGATGAAGAATGATAGGAACCAAGGCTTTAGCCTTCT
C
AACTCATTGACTGGAACAAACCATAGCATTGGGTCAGCAGATCCCTGTCACCCAGAGCAACCCCATTTG
CCA
GCAGCAGATAGTACTGAATCCCTCTCTGATCATCGGGGTGGTGCATCTAACACAACAGATGCCCAGG
TT
GATAGCATTGTGGATCCCATGTTAGATCTGGATATTCAAGAATTAGCCAGTCTTACCACTGGAGGAGG
A
GATGTGGAGAATTTTGAAAGACTCTTTTCAAAGTTAAAGGAAATGAAAGACAAGGCTGCGACGCTTCCT
CAT
GAGCAAAGAAAAGTGCATGCAGAAAAGGTGGCCAAAGCATTCTGGATGGCAATCGGGGGAGACAGAG
AT
GAAATTGAAGGCCTTTCATCTGATGAAGAGCACTGA


Translation (315 aa):
MAAGVPCALVTSCSSVFSGDQLVQHILGTEDLIVEVTSNDAVRFYPWTIDNKYYSADINLCVVPNKFLVT
A
EIAESVQAFVVYFDSTQ
KSGLDSVSSWLPLAKAWLPEVMILVCDRVSEDGINRQKAQEWCIKHGFELVE
L
SPEELPEED
DDFPESTGVKRIVQALNANVWSNVVMKNDRNQGFSLLNSLTGTNHSIGSADPCHPEQPHL
P
AADSTESLSDHRGGASNTTDAQVDSIV
DPMLDLDIQELASLTTGGGDVENFERLFSKLKEMKDKAATLP
H
EQRKVHAEK
VAKAFWMAIGGDRDEIEGLSSDEEH



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser