NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS42048.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
42048.1 Public Homo sapiens 15 RPS27L 22 109 92 CCDS HistoryNCBI Gene:51065Re-query CCDS DB by CCDS ID:42048.1Re-query CCDS DB by GeneID:51065See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 5, NCBI annotation release 36.3, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 42048.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000330964.9 ENSP00000331019.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000330964.9Link to Ensembl Protein Viewer:ENSP00000331019.5Re-query CCDS DB by Nucleotide ID:ENST00000330964Re-query CCDS DB by Protein ID:ENSP00000331019
Original member NCBI NM_015920.3 NP_057004.1 Updated not alive Link to Nucleotide Sequence:NM_015920.3Link to Protein Sequence:NP_057004.1Re-query CCDS DB by Nucleotide ID:NM_015920Re-query CCDS DB by Protein ID:NP_057004
Current member NCBI NM_015920.4 NP_057004.1 Accepted alive Link to Nucleotide Sequence:NM_015920.4Link to Protein Sequence:NP_057004.1Re-query CCDS DB by Nucleotide ID:NM_015920Re-query CCDS DB by Protein ID:NP_057004Link to BLAST:NP_057004.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_057004.1 84 Q71UM5 84 100% 0 0

Chromosomal Locations for CCDS 42048.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 15 (NC_000015.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 63154032 63154060 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 63155621 63155731 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 63156413 63156521 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 63157400 63157405 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (255 nt):
ATGCCTTTGGCTAGAGATTTACTACATCCGTCCTTGGAAGAGGAAAAGAAAAAACATAAAAAGAAACGCC
TA
GTACAAAGTCCAAATTCTTACTTTATGGATGTAAAATGTCCAGGTTGCTACAAGATCACCACGGTTTT
C
AGCCATGCTCAGACAGTGGTTCTTTGTGTAGGTTGTTCAACAGTGTTGTGCCAGCCTACAGGAGGAAAG
GCC
AGACTCACAGAAGGGTGTTCATTTAGAAGAAAGCAACACTAA


Translation (84 aa):
MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGK
A
RLTE
GCSFRRKQH



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser